5b5m

Crystal structure of the Sr-substituted LH1-RC complex from Tch. tepidum

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic reaction center cytochrome c subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P5_THETI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–333； UniProt 1–333 Author chain o； PDBConstruct 1–333； UniProt 1–333

Photosynthetic reaction center L subunit

OrganismNot specified

UniProt D2Z0P3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P3_THETI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain L； PDBConstruct 1–281； UniProt 1–281 Author chain x； PDBConstruct 1–281； UniProt 1–281

Photosynthetic reaction center M subunit

OrganismNot specified

UniProt A8ASG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8ASG6_THETI
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–319； UniProt 1–319 Author chain y； PDBConstruct 1–319； UniProt 1–319

Photosynthetic reaction center H subunit

OrganismNot specified

UniProt D2Z0P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） LH1 alpha polypeptide × 16 （D2Z0P2） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P9_THETI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H； PDBConstruct 1–259； UniProt 1–259 Author chain t； PDBConstruct 1–259； UniProt 1–259

LH1 alpha polypeptide

OrganismNot specified

UniProt D2Z0P2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 beta polypeptide × 16 （D2Z0P1） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P2_THETI
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain 1； PDBConstruct 1–61； UniProt 1–61 Author chain 3； PDBConstruct 1–61； UniProt 1–61 Author chain 5； PDBConstruct 1–61； UniProt 1–61 Author chain 7； PDBConstruct 1–61； UniProt 1–61 Author chain 9； PDBConstruct 1–61； UniProt 1–61 Author chain A； PDBConstruct 1–61； UniProt 1–61 Author chain AA； PDBConstruct 1–61； UniProt 1–61 Author chain AC； PDBConstruct 1–61； UniProt 1–61 Author chain AE； PDBConstruct 1–61； UniProt 1–61 Author chain AG； PDBConstruct 1–61； UniProt 1–61 Author chain AI； PDBConstruct 1–61； UniProt 1–61 Author chain AK； PDBConstruct 1–61； UniProt 1–61 Author chain D； PDBConstruct 1–61； UniProt 1–61 Author chain F； PDBConstruct 1–61； UniProt 1–61 Author chain I； PDBConstruct 1–61； UniProt 1–61 Author chain K； PDBConstruct 1–61； UniProt 1–61 Author chain O； PDBConstruct 1–61； UniProt 1–61 Author chain Q； PDBConstruct 1–61； UniProt 1–61 Author chain S； PDBConstruct 1–61； UniProt 1–61 Author chain U； PDBConstruct 1–61； UniProt 1–61 Author chain W； PDBConstruct 1–61； UniProt 1–61 Author chain Y； PDBConstruct 1–61； UniProt 1–61 Author chain d； PDBConstruct 1–61； UniProt 1–61 Author chain f； PDBConstruct 1–61； UniProt 1–61 Author chain h； PDBConstruct 1–61； UniProt 1–61 Author chain j； PDBConstruct 1–61； UniProt 1–61 Author chain l； PDBConstruct 1–61； UniProt 1–61 Author chain m； PDBConstruct 1–61； UniProt 1–61 Author chain p； PDBConstruct 1–61； UniProt 1–61 Author chain r； PDBConstruct 1–61； UniProt 1–61 Author chain u； PDBConstruct 1–61； UniProt 1–61 Author chain w； PDBConstruct 1–61； UniProt 1–61

LH1 beta polypeptide

OrganismNot specified

UniProt D2Z0P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 36	Photosynthetic reaction center cytochrome c subunit × 1 （D2Z0P5） Photosynthetic reaction center L subunit × 1 （D2Z0P3） Photosynthetic reaction center M subunit × 1 （A8ASG6） Photosynthetic reaction center H subunit × 1 （D2Z0P9） LH1 alpha polypeptide × 16 （D2Z0P2） PROTOPORPHYRIN IX CONTAINING FE × 4 STRONTIUM ION × 19 BACTERIOCHLOROPHYLL A × 36 BACTERIOPHEOPHYTIN A × 2 Ubiquinone-8 × 1 DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE × 8 FE (III) ION × 1 MENAQUINONE 8 × 1 SPIRILLOXANTHIN × 17 PHOSPHATE ION × 2 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2Z0P1_THETI
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain 0； PDBConstruct 1–47； UniProt 1–47 Author chain 2； PDBConstruct 1–47； UniProt 1–47 Author chain 4； PDBConstruct 1–47； UniProt 1–47 Author chain 6； PDBConstruct 1–47； UniProt 1–47 Author chain 8； PDBConstruct 1–47； UniProt 1–47 Author chain AB； PDBConstruct 1–47； UniProt 1–47 Author chain AD； PDBConstruct 1–47； UniProt 1–47 Author chain AF； PDBConstruct 1–47； UniProt 1–47 Author chain AH； PDBConstruct 1–47； UniProt 1–47 Author chain AJ； PDBConstruct 1–47； UniProt 1–47 Author chain AL； PDBConstruct 1–47； UniProt 1–47 Author chain B； PDBConstruct 1–47； UniProt 1–47 Author chain E； PDBConstruct 1–47； UniProt 1–47 Author chain G； PDBConstruct 1–47； UniProt 1–47 Author chain J； PDBConstruct 1–47； UniProt 1–47 Author chain N； PDBConstruct 1–47； UniProt 1–47 Author chain P； PDBConstruct 1–47； UniProt 1–47 Author chain R； PDBConstruct 1–47； UniProt 1–47 Author chain T； PDBConstruct 1–47； UniProt 1–47 Author chain V； PDBConstruct 1–47； UniProt 1–47 Author chain X； PDBConstruct 1–47； UniProt 1–47 Author chain Z； PDBConstruct 1–47； UniProt 1–47 Author chain c； PDBConstruct 1–47； UniProt 1–47 Author chain e； PDBConstruct 1–47； UniProt 1–47 Author chain g； PDBConstruct 1–47； UniProt 1–47 Author chain i； PDBConstruct 1–47； UniProt 1–47 Author chain k； PDBConstruct 1–47； UniProt 1–47 Author chain n； PDBConstruct 1–47； UniProt 1–47 Author chain q； PDBConstruct 1–47； UniProt 1–47 Author chain s； PDBConstruct 1–47； UniProt 1–47 Author chain v； PDBConstruct 1–47； UniProt 1–47 Author chain z； PDBConstruct 1–47； UniProt 1–47

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5b5m
Deposition date deposition_date	2016-05-12
Structure title title	Crystal structure of the Sr-substituted LH1-RC complex from Tch. tepidum
Keywords keywords	Bacterial photosynthesis, Light-harvesting complex, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5b5m__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5b5m__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5b5m__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.09 Å
Rg (electron density)	44.28 Å
Total Rg	44.79 Å
Atom count	25941
Residues	2773
Excluded volume	481850 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5b5m__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5b5m__assembly_2__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	Photosynthetic reaction center cytochrome c subunit
Molecular weight formula_weight	36630.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,o
Atom count atom_count	51893

MSPAQQLTLPAVIVVASVMLLGCEGPPPGTEQIGYRGVGMENYYNKRQRALSIQANQPVESLPAADSTGPKASEVYQNVQVLKDLSVGEFTRTMVAVTTWVSPKEGCNYCHVPGNWASDDIYTKVVSRRMFELVRAANSDWKAHVAETGVTCYTCHRGNPVPKYAWVTDPGPKYPSGLKPTGQNYGSKTVAYASLPFDPLTPFLDQANEIRITGNAALAGSNPASLKQAEWTFGLMMNISDSLGVGCTFCHNTRAFNDWTQSTPKRTTAWYAIRHVRDINQNYIWPLNDVLPASRKGPYGDPLRVSCMTCHQAVNKPLYGAQMAKDYPGLYKT

Entity 2 Entity 2 polymer

Description description	Photosynthetic reaction center L subunit
Molecular weight formula_weight	31520.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,x

MAMLSFEKKYRVRGGTLIGGDLFDFWVGPFYVGFFGVVGFCFTLLGVLLIVWGATIGPTGPTSDLQTYNLWRISIAPPDLSYGLRMAPLTEGGLWQIITICAAGAFISWALREVEICRKLGIGFHVPFAFSFAIGAYLVLVFVRPLLMGAWGHGFPYGILSHLDWVSNVGYQFLHFHYNPAHMLAISFFFTNCLALSMHGSLILSVTNPQKGEPVKTSEHENTFFRDIVGYSIGALAIHRLGLFLALSAAFWSAVCILISGPFWTRGWPEWWNWWLELPLW

Entity 3 Entity 3 polymer

Description description	Photosynthetic reaction center M subunit
Molecular weight formula_weight	35976.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,y

MPEYQNIFTAVQVRAPAYPGVPLPKGNLPRIGRPIFSYWLGKIGDAQIGPIYLGLTGTLSIFFGLVAISIIGFNMLASVHWDVFQFLKHFFWLGLEPPPPQYGLRIPPLSEGGWWLMAGLFLTLSILLWWVRTYKRAEALGMSQHLSWAFAAAIFFYLVLGFIRPVMMGSWAKAVPFGIFPHLDWTAAFSIRYGNLYYNPFHMLSIAFLYGSALLFAMHGATILSVSRFGGDREIDQITHRGTAAERAALFWRWTMGFNVTMESIHRWAWWCAVLTVITAGIGILLSGTVVDNWYLWAVKHGMAPAYPEVVTAVNPYET

Entity 4 Entity 4 polymer

Description description	Photosynthetic reaction center H subunit
Molecular weight formula_weight	28213.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,t

MSAGITHYIDAAQITIWAFWLFFFGLIIYLRREDKREGYPLDSDRTERSGGRVKVVGFPDLPDPKTFVLPHNGGTVVAPRVEAPVAVNATPFSPAPGSPLVPNGDPMLSGFGPAASPDRPKHCDLTFEGLPKIVPMRVAKEFSIAEGDPDPRGMTVVGLDGEVAGTVSDVWVDRSEPQIRYLEVEVAANKKKVLLPIGFSRFDKKARKVKVDAIKAAHFANVPTLSNPDQVTLYEEDKVCAYYAGGKLYATAERAGPLL

Entity 5 Entity 5 polymer

Description description	LH1 alpha polypeptide
Molecular weight formula_weight	7034.4 kDa
Source method src_method	nat
Copy count entity_count	32

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,F,I,K,O,Q,S,U,W,Y,1,3,5,7,9,m,p,r,u,w,AA,AC,AE,AG,AI,AK,d,f,h,j,l

MFTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNIPVSYQALGKK

Entity 6 Entity 6 polymer

Description description	LH1 beta polypeptide
Molecular weight formula_weight	5534.5 kDa
Source method src_method	nat
Copy count entity_count	32

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,G,J,N,P,R,T,V,X,Z,2,4,6,8,0,n,q,s,v,z,AB,AD,AF,AH,AJ,AL,e,g,i,k,c

MAEQKSLTGLTDDEAKEFHAIFMQSMYAWFGLVVIAHLLAWLYRPWL

Entity 7 Entity 7 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	nat
Copy count entity_count	8

Entity 8 Entity 8 non-polymer

Description description	STRONTIUM ION
Molecular weight formula_weight	87.6 kDa
Source method src_method	syn
Copy count entity_count	38

Entity 9 Entity 9 non-polymer

Description description	BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	72

Entity 10 Entity 10 non-polymer

Description description	BACTERIOPHEOPHYTIN A
Molecular weight formula_weight	889.2 kDa
Source method src_method	nat
Copy count entity_count	4

Entity 11 Entity 11 non-polymer

Description description	Ubiquinone-8
Molecular weight formula_weight	727.1 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	DI-PALMITOYL-3-SN-PHOSPHATIDYLETHANOLAMINE
Molecular weight formula_weight	692.0 kDa
Source method src_method	nat
Copy count entity_count	16

Entity 13 Entity 13 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	MENAQUINONE 8
Molecular weight formula_weight	717.1 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	SPIRILLOXANTHIN
Molecular weight formula_weight	596.9 kDa
Source method src_method	nat
Copy count entity_count	34

Entity 16 Entity 16 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	nat
Copy count entity_count	4

Entity 17 Entity 17 non-polymer

Description description	(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate
Molecular weight formula_weight	749.0 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 18 Entity 18 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	6

▶

Unit-cell length a length_a	164.888 Å
Unit-cell length b length_b	148.946 Å
Unit-cell length c length_c	210.226 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	108.18 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	64

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	48.182 Å
R factor r_factor	0.2732
R_work r_work	0.2713
R_free r_free	0.3093

Crystal structure of the Sr-substituted LH1-RC complex from Tch. tepidum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosynthetic reaction center cytochrome c subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center L subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center M subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center H subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LH1 alpha polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LH1 beta polypeptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5b5m__assembly_2__model_1

5b5m__assembly_2__model_1 | I(q)

5b5m__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 non-polymer

Entity 13 Entity 13 non-polymer