SAXSdb — 5but

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ktr system potassium uptake protein A,Ktr system potassium uptake protein A

Bacillus subtilis

UniProt O32080

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Ktr system potassium uptake protein B × 2 （O32081） POTASSIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KTRA_BACSU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–144； UniProt 1–144 Author chain A； PDBConstruct 149–282； UniProt 7–140 Author chain C； PDBConstruct 1–144； UniProt 1–144 Author chain C； PDBConstruct 149–282； UniProt 7–140 Author chain E； PDBConstruct 1–144； UniProt 1–144 Author chain E； PDBConstruct 149–282； UniProt 7–140 Author chain G； PDBConstruct 1–144； UniProt 1–144 Author chain G； PDBConstruct 149–282； UniProt 7–140

Ktr system potassium uptake protein B

Bacillus subtilis

UniProt O32081

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Ktr system potassium uptake protein A,Ktr system potassium uptake protein A × 4 （O32080） POTASSIUM ION × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	POTASSIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KTRB_BACSU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–445； UniProt 1–445 Author chain J； PDBConstruct 1–445； UniProt 1–445 Author chain K； PDBConstruct 1–445； UniProt 1–445 Author chain L； PDBConstruct 1–445； UniProt 1–445

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5but
Deposition date deposition_date	2015-06-04
Structure title title	Crystal structure of inactive conformation of KtrAB K+ transporter
Keywords keywords	membrane protein complex, membrane protein; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5but__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5but__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5but__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.29 Å
Rg (electron density)	42.55 Å
Total Rg	42.82 Å
Atom count	14930
Residues	1934
Excluded volume	271100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5but__assembly_1__model_1`	Hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5but__assembly_2__model_1`	Dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Ktr system potassium uptake protein A,Ktr system potassium uptake protein A
Molecular weight formula_weight	32038.7 kDa
Mutation mutation	truncation of C-terminal domain,truncation of C-terminal domain
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	21476

MGRIKNKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENVLNYLEGSKQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLGIRNFEYVIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGADRIIHPEKDMGVKIAQSLSDENLELVPR

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Ktr system potassium uptake protein B
Molecular weight formula_weight	48158.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L

MTLQKDKVIKWVRFTPPQVLAIGFFLTIIIGAVLLMLPISTTKPLSWIDALFTAASATTVTGLAVVDTGTQFTVFGQTVIMGLIQIGGLGFMTFAVLIVMILAAAIGLKERMLVQEALNQPTIGGVIGLVKVLFLFSISIELIAALILSIRLVPQYGWSSGLFASLFHAISAFNNAGFSLWPDNLMSYVGDPTVNLVITFLFITGGIGFTVLFDVMKQRRFKTFSLHTALMLTGTLMLNAIAMLTVFILEYSNPGTLGHLAAVDKLWASYFQAVTPRTAGFNSLDFGSMREGTIVFTLLLMFIGAGSASTASGIKLTTFIVILTSVIAYLRGKKETVIFRRSIKYPIIIKALAVSVTSLFIVFLGIFALTITEQAPFLQIVFETFSAFGTVGLTMGLTPELTTAGKCIIIVIMFIGRIGPLTFVFSFAATEQSNIRYPDGEVFTG

Source Source

Source organism organism	Bacillus subtilis
NCBI taxonomy ID ncbi_taxonomy_id	1423
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	307.060 Å
Unit-cell length b length_b	79.410 Å
Unit-cell length c length_c	205.650 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	98.10 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	5.970 Å
Low-resolution limit resolution_low	200.000 Å
R factor r_factor	—
R_work r_work	0.3250
R_free r_free	0.3390

Crystal structure of inactive conformation of KtrAB K+ transporter

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ktr system potassium uptake protein A,Ktr system potassium uptake protein A

State in the Current Structure

Other States of the Same Protein in the Database

Ktr system potassium uptake protein B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5but__assembly_1__model_1

5but__assembly_1__model_1 | I(q)

5but__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

Crystal structure of inactive conformation of KtrAB K+ transporter

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ktr system potassium uptake protein A,Ktr system potassium uptake protein A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ktr system potassium uptake protein B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5but__assembly_1__model_1

5but__assembly_1__model_1 | I(q)

5but__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)