SAXSdb — 5c7e

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ASPR2 protein

Oryza sativa

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain A； UniProt 1–209 Chain B； UniProt 1–209 Chain C； UniProt 1–209 Chain D； UniProt 1–209	Fragment：N-terminal domain (UNP residues 1-209)	Auxin-responsive protein IAA10 × 4 （Q38828） ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；20% w/v PEG 3,350, 0.2 M sodium citrate tribasic dihydrate	Resolution 3.10 Å R-free 0.229
2	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain E； UniProt 1–209 Chain F； UniProt 1–209	Fragment：N-terminal domain (UNP residues 1-209)	Auxin-responsive protein IAA10 × 4 （Q38828） ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；20% w/v PEG 3,350, 0.2 M sodium citrate tribasic dihydrate	Resolution 3.10 Å R-free 0.229

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 5C7E	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4ZHE Crystal structure of the SeMet substituted Topless related protein 2 (TPR2) N-terminal domain (1-209) from rice Deposited 2015-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–209（209 aa） Fragment：N-TERMINAL DOMAIN (UNP residues 1-209) Chain B 1–209（209 aa） Fragment：N-TERMINAL DOMAIN (UNP residues 1-209) Chain C 1–209（209 aa） Fragment：N-TERMINAL DOMAIN (UNP residues 1-209) Chain D 1–209（209 aa） Fragment：N-TERMINAL DOMAIN (UNP residues 1-209)	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；25% w/v PEG 3,350, 0.2 M Magnesium chloride, 0.1 M BIS-TRIS, pH 6.5, 19.6 mM 5-Methyl-6-O-(N-heptylcarbamoyl)-alpha-D-glucopyranoside	Resolution 2.50 Å R-free 0.242
5C6Q Crystal structure of the apo TOPLESS related protein 2 (TPR2) N-terminal domain (1-209) from rice Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；25% PEG 3350, 0.2 M magnesium chloride, 0.1 M BIS-TRIS, pH 6.5	Resolution 3.25 Å R-free 0.270
5C6V Crystal structure of the rice Topless related protein 2 (TPR2) N-terminal domain (1-209) in complex with Arabidopsis NINJA peptide Deposited 2015-06-23	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209) Chain B 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209) Chain C 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209) Chain D 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；25% w/v PEG 3,350, 0.2 M NaCl, 0.1 M BIS-TRIS pH 5.5, 3.0% w/v D-(+)-glucose monohydrate	Resolution 3.10 Å R-free 0.286
5C7F Crystal structure of the rice Topless related protein 2 (TPR2) N-terminal domain (1-209) in complex with Arabidopsis IAA1 peptide Deposited 2015-06-24	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209) Chain B 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209) Chain C 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209) Chain D 1–209（209 aa） Fragment：N-terminal domain (UNP residues 1-209)	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；25% w/v PEG 3,350, 0.2 M NaCl, 0.1 M BIS-TRIS pH 5.5	Resolution 2.70 Å R-free 0.256
5J9K Crystal structure of the rice Topless related protein 2 (TPR2) N-terminal topless domain (1-209) in complex with rice D53 repressor EAR peptide motif Deposited 2016-04-10	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–209（209 aa） Fragment：N-terminal topless domain (UNP residues 1-209) Chain B 1–209（209 aa） Fragment：N-terminal topless domain (UNP residues 1-209)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；25% w/v Polyethylene glycol 3350, 0.2 M Ammonium sulfate, 0.1 M BIS-TRIS, pH 6.5	Resolution 2.55 Å R-free 0.253
5JA5 Crystal structure of the rice Topless related protein 2 (TPR2) N-terminal topless domain (1-209) L111A and L130A mutant in complex with rice D53 repressor EAR peptide motif Deposited 2016-04-12	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–209（209 aa） Fragment：N-terminal topless domain (UNP residues 1-209)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.8；293 K；20% w/v Polyethylene glycol 3350, 0.2 M Potassium phosphate monobasic, pH 4.8	Resolution 2.00 Å R-free 0.228
5JGC Crystal structure of the rice Topless related protein 2 (TPR2) N-terminal topless domain (1-209) L111A, L130A, L179A and I195A mutant Deposited 2016-04-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–209（209 aa） Fragment：N-terminal topless domain (UNP residues 1-209)	Not recorded	ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；15% w/v Polyethylene glycol 4000, 0.2 M Magnesium chloride hexahydrate, 0.1 M TRIS hydrochloride pH 8.5	Resolution 2.08 Å R-free 0.246
5JHP Crystal structure of the rice Topless related protein 2 (TPR2) N-terminal topless domain (1-209) L179A and I195A mutant in complex with rice D53 repressor EAR peptide motif Deposited 2016-04-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–209（209 aa） Fragment：N-terminal topless domain (UNP residues 1-209) Chain B 1–209（209 aa） Fragment：N-terminal topless domain (UNP residues 1-209) Chain C 1–209（209 aa） Fragment：N-terminal topless domain (UNP residues 1-209) Chain D 1–209（209 aa） Fragment：N-terminal topless domain (UNP residues 1-209)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；20% w/v Polyethylene glycol 3350, 0.2 M Lithium sulfate monohydrate, pH 6.0	Resolution 3.15 Å R-free 0.284

8 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q5NBT9_ORYSJ
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–209； UniProt 1–209 Author chain B； PDBConstruct 1–209； UniProt 1–209 Author chain C； PDBConstruct 1–209； UniProt 1–209 Author chain D； PDBConstruct 1–209； UniProt 1–209 Author chain E； PDBConstruct 1–209； UniProt 1–209 Author chain F； PDBConstruct 1–209； UniProt 1–209

Auxin-responsive protein IAA10

OrganismNot specified

UniProt Q38828

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain G； UniProt 41–51 Chain H； UniProt 41–51 Chain I； UniProt 41–51 Chain J； UniProt 41–51	Fragment：UNP residues 41-51	ASPR2 protein × 4 （Q5NBT9） ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；20% w/v PEG 3,350, 0.2 M sodium citrate tribasic dihydrate	Resolution 3.10 Å R-free 0.229
2	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain K； UniProt 41–51 Chain L； UniProt 41–51	Fragment：UNP residues 41-51	ASPR2 protein × 4 （Q5NBT9） ZN ZINC ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293 K；20% w/v PEG 3,350, 0.2 M sodium citrate tribasic dihydrate	Resolution 3.10 Å R-free 0.229

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	IAA10_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–11； UniProt 41–51 Author chain H； PDBConstruct 1–11； UniProt 41–51 Author chain I； PDBConstruct 1–11； UniProt 41–51 Author chain J； PDBConstruct 1–11； UniProt 41–51 Author chain K； PDBConstruct 1–11； UniProt 41–51 Author chain L； PDBConstruct 1–11； UniProt 41–51

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5c7e
Deposition date deposition_date	2015-06-24
Structure title title	Crystal structure of the rice Topless related protein 2 (TPR2) N-terminal domain (1-209) in complex with Arabidopsis IAA10 peptide
Keywords keywords	;transcriptional corepressor, alpha-helical structure, tetrameric protein, plant transcriptional repression, TRANSCRIPTION, Plant development ;; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	52.72 Å
Radius of gyration Rg (electron density) rg_electron	53.05 Å
Forward intensity I(0) i0	310141000.00
Molecular weight molecular_weight	150960.0 kDa
Excluded volume excluded_volume	191300 Å³
Envelope volume envelope_volume	295410 Å³
Hydration-shell volume shell_volume	52034 Å³
Envelope diameter envelope_diameter	194.0 Å
Shell Rg shell_rg	48.59 Å
Envelope Rg envelope_rg	51.62 Å
Shape Rg shape_rg	53.00 Å
Total Rg total_rg	53.06 Å
Total atoms total_atoms	10635
Residues n_residues	1281
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	185.1 Å
Rg (real space) rg_real	53.22 Å
Rg uncertainty (real space) rg_real_error	3.33 Å
I(0) (real space) i0_real	3.1010e+08
I(0) uncertainty (real space) i0_real_error	7.3550e+06
Rg (reciprocal space) rg_reciprocal	52.28 Å
I(0) (reciprocal space) i0_reciprocal	309700000.0000
Solution quality estimate total_estimate	0.8217
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	49.4 Å
Skewness Skewness skewness	0.545
Kurtosis Kurtosis kurtosis	-0.327
Angular range angular_range	— – 0.1500 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	14360000.0000
Real-space data points n_real_points	31
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.725; Stabil: 0.995; Sysdev: 1.000; Positv: 1.000; Valcen: 0.874; Smooth: 0.646

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	ASPR2 protein
Molecular weight formula_weight	24903.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	10658

MSSLSRELVFLILQFLDEEKFKETVHKLEQESGFFFNMKYFEEKVHAGEWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQKYLEALDRHDRAKAVDILVKDLKVFSTFNEELYKEITQLLTLENFRENEQLSKYGDTKSARSIMLIELKKLIEANPLFREKLVFPTLKASRLRTLINQSLNWQHQLCKNPRPNPDIKTLFTDHTCTPPNG

来源 Source

来源生物 organism	Oryza sativa
通用名 common_name	Rice
NCBI Class编号 ncbi_taxonomy_id	4530
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Auxin-responsive protein IAA10
Molecular weight formula_weight	1160.3 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L

SETELDLALGL

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	23

▶

8. Citations (1)

▶

Unit-cell length a length_a	162.668 Å
Unit-cell length b length_b	162.668 Å
Unit-cell length c length_c	157.250 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	3.100 Å
Low-resolution limit resolution_low	44.995 Å
R factor r_factor	0.1977
R_work r_work	0.1961
R_free r_free	0.2287

fit	/app/data/saxs_computation/c7/5c7e/5c7e.fit
pddf	/app/data/pr_computation/c7/5c7e/5c7e.pr.out
profile	/app/data/saxs_computation/c7/5c7e/5c7e.dat

Crystal structure of the rice Topless related protein 2 (TPR2) N-terminal domain (1-209) in complex with Arabidopsis IAA10 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

ASPR2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Auxin-responsive protein IAA10

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)