SAXSdb — 5d28

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

GM-CSF/IL-2 inhibition factor

Orf virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 4 其他Polymer 4	Granulocyte-macrophage colony-stimulating factor × 2 （P28773） ;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SULFATE ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9J5U5_ORFV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–246； UniProt 20–265 Author chain D； PDBConstruct 1–246； UniProt 20–265

Granulocyte-macrophage colony-stimulating factor

Ovis aries

UniProt P28773

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 4 其他Polymer 4	GM-CSF/IL-2 inhibition factor × 2 （Q9J5U5） ;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 SULFATE ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSF2_SHEEP
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–127； UniProt 18–144 Author chain C； PDBConstruct 1–127； UniProt 18–144

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5d28
Deposition date deposition_date	2015-08-05
Structure title title	Complex of GM-CSF/IL-2 inhibition factor with Granulocyte-macrophage colony-stimulating factor
Keywords keywords	Signaling Protein, Cytokine, Host-pathogen interactions, Immunology, viral protein; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5d28__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5d28__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5d28__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.67 Å
Rg (electron density)	27.79 Å
Total Rg	28.53 Å
Atom count	5589
Residues	688
Excluded volume	98861 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5d28__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	GM-CSF/IL-2 inhibition factor
Molecular weight formula_weight	27985.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	5606

AQWIGERDFCTAHAQDVFARLQVWMRIDRNVTAADNSSACALAIETPPSNFDADVYVAAAGINVSVSAINCGFFNMRQVETTYNTARRQMYVYMDSWDPWVIDDPQPLFSQEYENETLPYLLEVLELARLYIRVGCTVPGEQPFEVIPGIDYPHTGMEFLQHVLRPNRRFAPAKLHMDLEVDHRCVSAVHVKAFLQDACSARKARTPLYFAGHGCNHPDRRPKNPVPRPQHVSSPISRKCSMQTAR

Source Source

Source organism organism	Orf virus
Common name common_name	ORFV
NCBI taxonomy ID ncbi_taxonomy_id	10258
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Granulocyte-macrophage colony-stimulating factor
Molecular weight formula_weight	14426.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

APTRQPSPVTRPWQHVDAIKEALSLLNDSTDTAAVMDETVEVVSEMFDSQEPTCLQTRLELYKQGLRGSLTSLTGSLTMMASHYKKHCPPTQETSCETQIITFKSFKENLKDFLFIIPFDCWEPVQK

Source Source

Source organism organism	Ovis aries
Common name common_name	Sheep
NCBI taxonomy ID ncbi_taxonomy_id	9940
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 branched

Description description	;alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	748.7 kDa
Source method src_method	man
Copy count entity_count	2

Source Source

Source organism organism	Orf virus
NCBI taxonomy ID ncbi_taxonomy_id	10258
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	2

Source Source

Source organism organism	Orf virus
NCBI taxonomy ID ncbi_taxonomy_id	10258
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	2

Source Source

Source organism organism	Orf virus
NCBI taxonomy ID ncbi_taxonomy_id	10258
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	17

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d5d28b_
Class class	a — All alpha proteins
Fold Fold fold	a.26 — 4-helical cytokines
Superfamily Superfamily superfamily	a.26.1 — 4-helical cytokines
Family Family family	a.26.1.2 — Short-chain cytokines

Domain ID domain_id	d5d28c_
Class class	a — All alpha proteins
Fold Fold fold	a.26 — 4-helical cytokines
Superfamily Superfamily superfamily	a.26.1 — 4-helical cytokines
Family Family family	a.26.1.2 — Short-chain cytokines

CATH v4.4 (2 domains)

Domain ID domain_id	5d28B00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	5d28C00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	145.700 Å
Unit-cell length b length_b	105.600 Å
Unit-cell length c length_c	73.490 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.31 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.845 Å
Low-resolution limit resolution_low	44.063 Å
R factor r_factor	0.1928
R_work r_work	0.1905
R_free r_free	0.2353

Complex of GM-CSF/IL-2 inhibition factor with Granulocyte-macrophage colony-stimulating factor

1. Protein Identity and Related Structures Protein Identity & Related Structures

GM-CSF/IL-2 inhibition factor

State in the Current Structure

Other States of the Same Protein in the Database

Granulocyte-macrophage colony-stimulating factor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5d28__assembly_1__model_1

5d28__assembly_1__model_1 | I(q)

5d28__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 branched

Source Source

Entity 4 Entity 4 branched

Source Source

Entity 5 Entity 5 non-polymer

Source Source

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Complex of GM-CSF/IL-2 inhibition factor with Granulocyte-macrophage colony-stimulating factor

1. Protein Identity and Related Structures Protein Identity & Related Structures

GM-CSF/IL-2 inhibition factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Granulocyte-macrophage colony-stimulating factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5d28__assembly_1__model_1

5d28__assembly_1__model_1 | I(q)

5d28__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 branched

Source Source

Entity 4 Entity 4 branched

Source Source

Entity 5 Entity 5 non-polymer

Source Source

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)