SAXSdb — 5hzg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Strigolactone esterase D14

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	F-box/LRR-repeat MAX2 homolog × 1 （Q5VMP0） SKP1-like protein 1A × 1 （Q39255） (2Z)-2-methylbut-2-ene-1,4-diol × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	F-box/LRR-repeat MAX2 homolog × 1 （Q5VMP0） SKP1-like protein 1A × 1 （Q39255） (2Z)-2-methylbut-2-ene-1,4-diol × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D14_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–267； UniProt 1–267 Author chain E； PDBConstruct 1–267； UniProt 1–267

F-box/LRR-repeat MAX2 homolog

Oryza sativa subsp. japonica

UniProt Q5VMP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Strigolactone esterase D14 × 1 （Q9SQR3） SKP1-like protein 1A × 1 （Q39255） (2Z)-2-methylbut-2-ene-1,4-diol × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Strigolactone esterase D14 × 1 （Q9SQR3） SKP1-like protein 1A × 1 （Q39255） (2Z)-2-methylbut-2-ene-1,4-diol × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MAX2_ORYSJ
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 21–740； UniProt 1–720 Author chain F； PDBConstruct 21–740； UniProt 1–720

SKP1-like protein 1A

Arabidopsis thaliana

UniProt Q39255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Strigolactone esterase D14 × 1 （Q9SQR3） F-box/LRR-repeat MAX2 homolog × 1 （Q5VMP0） (2Z)-2-methylbut-2-ene-1,4-diol × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Strigolactone esterase D14 × 1 （Q9SQR3） F-box/LRR-repeat MAX2 homolog × 1 （Q5VMP0） (2Z)-2-methylbut-2-ene-1,4-diol × 1 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SKP1A_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 10–169； UniProt 1–160 Author chain G； PDBConstruct 10–169； UniProt 1–160

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5hzg
Deposition date deposition_date	2016-02-02
Structure title title	The crystal structure of the strigolactone-induced AtD14-D3-ASK1 complex
Keywords keywords	F-box protein, receptor, HYDROLASE-SIGNALING PROTEIN-PROTEIN BINDING complex; HYDROLASE/SIGNALING PROTEIN/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5hzg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5hzg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5hzg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.11 Å
Rg (electron density)	32.51 Å
Total Rg	33.18 Å
Atom count	7823
Residues	1002
Excluded volume	139810 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5hzg__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5hzg__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Strigolactone esterase D14
Molecular weight formula_weight	29653.7 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E
Atom count atom_count	15676

MSQHNILEALNVRVVGTGDRILFLAHGFGTDQSAWHLILPYFTQNYRVVLYDLVCAGSVNPDYFDFNRYTTLDPYVDDLLNIVDSLGIQNCAYVGHSVSAMIGIIASIRRPELFSKLILIGFSPRFLNDEDYHGGFEEGEIEKVFSAMEANYEAWVHGFAPLAVGADVPAAVREFSRTLFNMRPDISLFVSRTVFNSDLRGVLGLVRVPTCVIQTAKDVSVPASVAEYLRSHLGGDTTVETLKTEGHLPQLSAPAQLAQFLRRALPR

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	Mouse-ear cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli K-12

Entity 2 Entity 2 polymer

Description description	F-box/LRR-repeat MAX2 homolog
Molecular weight formula_weight	81153.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F

GAMGSGIQRPTSTSSLVAAAMAEEEEVEEGRSSSSAILDLPEPLLLHILSFLTDVRSRHRAALACGRMRAAERATRSELSLRGDPRSPGFLFLSHAFRFPALEHLDLSLVSPWGHPLLSSVPPCGGGGGGAPSASSSSGMNVYHPEAISEQNAFIAARLAGCFPAVTSLAVYCRDPTTLANLTPHWQASLRRVKLVRWHQRPPTLPDGADLEPLLETCAALRELDLSEFYCWTEDVVRALTTHPSATAALTHLDLGLAAATDGFKSSELGPIAASCPNLRKLVAPCLFNPRFSDCVGDDALLSLATSCPRLTVLRLSEPFEAAANIQREEAAITVAGLVAFFAALPALEDFTMDLQHNVLEAAPAMEALARRCPRIKFLTLGSFQGLCKASWLHLDGVAVCGGLESLYMKNCQDLTDASLAAIGRGCRRLAKFGIHGCDLVTSAGIRRLAFTLRPTLKEVTVLHCRLLHTAECLTALSPIRDRIESLEINCVWNTTEQPCSVANGTTTECDPEDDELGEVYESAAKKCRYMEFDDLGSWEMLRSLSLWFSAGQLLSPLISAGLDSCPVLEEISIKVEGDCRTCPRPAPRTIFGLSDLAGFPVLAKMKLDLSEAVGYALTAPTGQMDLSLWERFYLHGIESLQTLYELDYWPPQDKDVHHRSLTLPAVGLIQRCVGLRKLFIHGTTHEHFMTFFLSIPNLRDMQLREDYYPAPENDLMFTEMRAESWLRFEVQLNSRQIDD

Source Source

Source organism organism	Oryza sativa subsp. japonica
Common name common_name	Rice
NCBI taxonomy ID ncbi_taxonomy_id	39947
Host organism host_organism	Insect cell expression vector pTIE1

Entity 3 Entity 3 polymer

Description description	SKP1-like protein 1A
Molecular weight formula_weight	19004.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G

MDYKDDDDKMSAKKIVLKSSDGESFEVEEAVALESQTIAHMVEDDCVDNGVPLPNVTSKILAKVIEYCKRHVEAAASKAEAVEGAATSDDDLKAWDADFMKIDQATLFELILAANYLNIKNLLDLTCQTVADMIKGKTPEEIRTTFNIKNDFTPEEEEEVRRENQWAFE

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	Mouse-ear cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Insect cell expression vector pTIE1

Entity 4 Entity 4 non-polymer

Description description	(2Z)-2-methylbut-2-ene-1,4-diol
Molecular weight formula_weight	102.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	24

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	5hzgA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1820 — Alpha/Beta hydrolase fold, catalytic domain

Domain ID domain_id	5hzgC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

Domain ID domain_id	5hzgE00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1820 — Alpha/Beta hydrolase fold, catalytic domain

Domain ID domain_id	5hzgG00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	710 — Potassium Channel Kv1.1; Chain A
Homologous superfamily homologous superfamily	10 — Potassium Channel Kv1.1; Chain A

▶

Unit-cell length a length_a	106.397 Å
Unit-cell length b length_b	172.979 Å
Unit-cell length c length_c	186.845 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	49.070 Å
R factor r_factor	0.2497
R_work r_work	0.2462
R_free r_free	0.3159

The crystal structure of the strigolactone-induced AtD14-D3-ASK1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Strigolactone esterase D14

State in the Current Structure

Other States of the Same Protein in the Database

F-box/LRR-repeat MAX2 homolog

State in the Current Structure

Other States of the Same Protein in the Database

SKP1-like protein 1A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5hzg__assembly_1__model_1

5hzg__assembly_1__model_1 | I(q)

5hzg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

The crystal structure of the strigolactone-induced AtD14-D3-ASK1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Strigolactone esterase D14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

F-box/LRR-repeat MAX2 homolog

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SKP1-like protein 1A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5hzg__assembly_1__model_1

5hzg__assembly_1__model_1 | I(q)

5hzg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)