SAXSdb — 5j3d

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

Human respiratory syncytial virus A

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 12	14N4 heavy chain × 3 14N4 light chain × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	FUS_HRSVA
Isoform	—
PDB entities	3, 4
Chains and sequence ranges	Author chain E； PDBConstruct 1–73； UniProt 26–98 Author chain G； PDBConstruct 1–73； UniProt 26–98 Author chain J； PDBConstruct 1–73； UniProt 26–98 Author chain F； PDBConstruct 1–367； UniProt 147–513 Author chain I； PDBConstruct 1–367； UniProt 147–513 Author chain K； PDBConstruct 1–367； UniProt 147–513

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5j3d
Deposition date deposition_date	2016-03-30
Structure title title	Crystal structure of human Fab 14N4 in complex with post-fusion RSV F
Keywords keywords	antibody, virus, complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5j3d__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5j3d__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5j3d__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	57.84 Å
Rg (electron density)	58.07 Å
Total Rg	57.97 Å
Atom count	19902
Residues	2598
Excluded volume	354810 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5j3d__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	14N4 heavy chain
Molecular weight formula_weight	23597.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,H
Atom count atom_count	19902

QVQLVESGGGLIQPGGSLRLSCAVSGFTVSSKYMTWVRQAPGKGLEWVSVIYGGGSTYYADSVVGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASRLGVRATTGDLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	14N4 light chain
Molecular weight formula_weight	24001.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,L

VHSDIQMTQSPSTLSASVGDRVTITCRASQSISSWLAWYQQKPGKAPKLLIYDASSLESGVPSRFSGSGSGTEFTLTISSLQPDDFATYYCQQYNTYSWWTFGQGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Fusion glycoprotein F0
Molecular weight formula_weight	8301.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G,J

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQ

Source Source

Source organism organism	Human respiratory syncytial virus A
NCBI taxonomy ID ncbi_taxonomy_id	12814
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Fusion glycoprotein F0
Molecular weight formula_weight	43782.8 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,I,K

AIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLGLEVLFQGPHHHHHHHHSAWSHPQFEK

Source Source

Source organism organism	Human respiratory syncytial virus A
NCBI taxonomy ID ncbi_taxonomy_id	12814
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	235.130 Å
Unit-cell length b length_b	235.130 Å
Unit-cell length c length_c	220.142 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 42 21 2
Space-group number int_tables_number	94
Crystal system crystal_system	—

Resolution resolution	4.077 Å
Low-resolution limit resolution_low	49.500 Å
R factor r_factor	0.2579
R_work r_work	0.2568
R_free r_free	0.2819

Crystal structure of human Fab 14N4 in complex with post-fusion RSV F

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5j3d__assembly_1__model_1

5j3d__assembly_1__model_1 | I(q)

5j3d__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Crystal structure of human Fab 14N4 in complex with post-fusion RSV F

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5j3d__assembly_1__model_1

5j3d__assembly_1__model_1 | I(q)

5j3d__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)