SAXSdb — 5lhz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine/threonine-protein kinase PLK4

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	SCL-interrupting locus protein × 1 （Q15468） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	SCL-interrupting locus protein × 1 （Q15468） water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	SCL-interrupting locus protein × 1 （Q15468） water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PLK4_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–91； UniProt 884–970 Author chain B； PDBConstruct 5–91； UniProt 884–970 Author chain C； PDBConstruct 5–91； UniProt 884–970

SCL-interrupting locus protein

Homo sapiens

UniProt Q15468

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Serine/threonine-protein kinase PLK4 × 1 （O00444） water × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Serine/threonine-protein kinase PLK4 × 1 （O00444） water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Serine/threonine-protein kinase PLK4 × 1 （O00444） water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STIL_HUMAN
Isoform	Q15468-2
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 4–28； UniProt 726–750 Author chain E； PDBConstruct 4–28； UniProt 726–750 Author chain F； PDBConstruct 4–28； UniProt 726–750

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5lhz
Deposition date deposition_date	2016-07-13
Structure title title	PB3 Domain of Human PLK4 in Complex with Coiled-Coil Domain of STIL
Keywords keywords	Polo box domain, Centriole, Complex, transferase, structural protein; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5lhz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5lhz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5lhz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.54 Å
Rg (electron density)	13.06 Å
Total Rg	14.44 Å
Atom count	1596
Residues	100
Excluded volume	14177 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5lhz__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5lhz__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`5lhz__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Serine/threonine-protein kinase PLK4
Molecular weight formula_weight	9915.2 kDa
EC 编号 ec_number	2.7.11.21
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	4731

GPMGSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTPNFH

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli B

Entity 2 Entity 2 polymer

Description description	SCL-interrupting locus protein
Molecular weight formula_weight	3199.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

GGSLTEQDRQLRLLQAQIQRLLEAQSLM

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli B

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	5

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d5lhza_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.223 — Polo-box domain
Superfamily Superfamily superfamily	d.223.1 — Polo-box domain
Family Family family	d.223.1.1 — Swapped Polo-box domain

Domain ID domain_id	d5lhzb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.223 — Polo-box domain
Superfamily Superfamily superfamily	d.223.1 — Polo-box domain
Family Family family	d.223.1.1 — Swapped Polo-box domain

Domain ID domain_id	d5lhzc_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.223 — Polo-box domain
Superfamily Superfamily superfamily	d.223.1 — Polo-box domain
Family Family family	d.223.1.1 — Swapped Polo-box domain

CATH v4.4 (3 domains)

Domain ID domain_id	5lhzA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	30 — POLO box domain

Domain ID domain_id	5lhzB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	30 — POLO box domain

Domain ID domain_id	5lhzC00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1120 — Arylsulfatase, C-terminal domain
Homologous superfamily homologous superfamily	30 — POLO box domain

▶

Unit-cell length a length_a	68.360 Å
Unit-cell length b length_b	68.360 Å
Unit-cell length c length_c	137.390 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	2.510 Å
Low-resolution limit resolution_low	36.223 Å
R factor r_factor	0.2513
R_work r_work	0.2496
R_free r_free	0.2821

PB3 Domain of Human PLK4 in Complex with Coiled-Coil Domain of STIL

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine/threonine-protein kinase PLK4

State in the Current Structure

Other States of the Same Protein in the Database

SCL-interrupting locus protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5lhz__assembly_1__model_1

5lhz__assembly_1__model_1 | I(q)

5lhz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)

PB3 Domain of Human PLK4 in Complex with Coiled-Coil Domain of STIL

1. Protein Identity and Related Structures Protein Identity & Related Structures

Serine/threonine-protein kinase PLK4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SCL-interrupting locus protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5lhz__assembly_1__model_1

5lhz__assembly_1__model_1 | I(q)

5lhz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)