5neu

Localised Reconstruction of Integrin alpha V beta 6 bound to Foot and Mouth Disease Virus O1 Manisa - Pose B.

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

O1 Manisa VP1

Foot-and-mouth disease virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	Capsid protein × 60 （A0A1C6ZW60） O1 Manisa VP4 × 60 （E1ACS1） Integrin alpha-V × 60 （P06756） Integrin beta-6 × 60 （P18564） MAGNESIUM ION × 60 CALCIUM ION × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Capsid protein × 1 （A0A1C6ZW60） O1 Manisa VP4 × 1 （E1ACS1） Integrin alpha-V × 1 （P06756） Integrin beta-6 × 1 （P18564） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	Capsid protein × 5 （A0A1C6ZW60） O1 Manisa VP4 × 5 （E1ACS1） Integrin alpha-V × 5 （P06756） Integrin beta-6 × 5 （P18564） MAGNESIUM ION × 5 CALCIUM ION × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	Capsid protein × 6 （A0A1C6ZW60） O1 Manisa VP4 × 6 （E1ACS1） Integrin alpha-V × 6 （P06756） Integrin beta-6 × 6 （P18564） MAGNESIUM ION × 6 CALCIUM ION × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	Capsid protein × 1 （A0A1C6ZW60） O1 Manisa VP4 × 1 （E1ACS1） Integrin alpha-V × 1 （P06756） Integrin beta-6 × 1 （P18564） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6PMW3_9PICO
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–208； UniProt 725–932 Author chain 2； PDBConstruct 1–218； UniProt 287–504

Capsid protein

Foot-and-mouth disease virus

UniProt A0A1C6ZW60

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	O1 Manisa VP1 × 60 （Q6PMW3） O1 Manisa VP2 × 60 （Q6PMW3） O1 Manisa VP4 × 60 （E1ACS1） Integrin alpha-V × 60 （P06756） Integrin beta-6 × 60 （P18564） MAGNESIUM ION × 60 CALCIUM ION × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	O1 Manisa VP1 × 1 （Q6PMW3） O1 Manisa VP2 × 1 （Q6PMW3） O1 Manisa VP4 × 1 （E1ACS1） Integrin alpha-V × 1 （P06756） Integrin beta-6 × 1 （P18564） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	O1 Manisa VP1 × 5 （Q6PMW3） O1 Manisa VP2 × 5 （Q6PMW3） O1 Manisa VP4 × 5 （E1ACS1） Integrin alpha-V × 5 （P06756） Integrin beta-6 × 5 （P18564） MAGNESIUM ION × 5 CALCIUM ION × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	O1 Manisa VP1 × 6 （Q6PMW3） O1 Manisa VP2 × 6 （Q6PMW3） O1 Manisa VP4 × 6 （E1ACS1） Integrin alpha-V × 6 （P06756） Integrin beta-6 × 6 （P18564） MAGNESIUM ION × 6 CALCIUM ION × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	O1 Manisa VP1 × 1 （Q6PMW3） O1 Manisa VP2 × 1 （Q6PMW3） O1 Manisa VP4 × 1 （E1ACS1） Integrin alpha-V × 1 （P06756） Integrin beta-6 × 1 （P18564） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1C6ZW60_9PICO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–220； UniProt 304–523

O1 Manisa VP4

Foot-and-mouth disease virus

UniProt E1ACS1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	O1 Manisa VP1 × 60 （Q6PMW3） O1 Manisa VP2 × 60 （Q6PMW3） Capsid protein × 60 （A0A1C6ZW60） Integrin alpha-V × 60 （P06756） Integrin beta-6 × 60 （P18564） MAGNESIUM ION × 60 CALCIUM ION × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	O1 Manisa VP1 × 1 （Q6PMW3） O1 Manisa VP2 × 1 （Q6PMW3） Capsid protein × 1 （A0A1C6ZW60） Integrin alpha-V × 1 （P06756） Integrin beta-6 × 1 （P18564） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	O1 Manisa VP1 × 5 （Q6PMW3） O1 Manisa VP2 × 5 （Q6PMW3） Capsid protein × 5 （A0A1C6ZW60） Integrin alpha-V × 5 （P06756） Integrin beta-6 × 5 （P18564） MAGNESIUM ION × 5 CALCIUM ION × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	O1 Manisa VP1 × 6 （Q6PMW3） O1 Manisa VP2 × 6 （Q6PMW3） Capsid protein × 6 （A0A1C6ZW60） Integrin alpha-V × 6 （P06756） Integrin beta-6 × 6 （P18564） MAGNESIUM ION × 6 CALCIUM ION × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	O1 Manisa VP1 × 1 （Q6PMW3） O1 Manisa VP2 × 1 （Q6PMW3） Capsid protein × 1 （A0A1C6ZW60） Integrin alpha-V × 1 （P06756） Integrin beta-6 × 1 （P18564） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E1ACS1_9PICO
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 4； PDBConstruct 1–85； UniProt 202–286

Integrin alpha-V

Homo sapiens

UniProt P06756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	O1 Manisa VP1 × 60 （Q6PMW3） O1 Manisa VP2 × 60 （Q6PMW3） Capsid protein × 60 （A0A1C6ZW60） O1 Manisa VP4 × 60 （E1ACS1） Integrin beta-6 × 60 （P18564） MAGNESIUM ION × 60 CALCIUM ION × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	O1 Manisa VP1 × 1 （Q6PMW3） O1 Manisa VP2 × 1 （Q6PMW3） Capsid protein × 1 （A0A1C6ZW60） O1 Manisa VP4 × 1 （E1ACS1） Integrin beta-6 × 1 （P18564） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	O1 Manisa VP1 × 5 （Q6PMW3） O1 Manisa VP2 × 5 （Q6PMW3） Capsid protein × 5 （A0A1C6ZW60） O1 Manisa VP4 × 5 （E1ACS1） Integrin beta-6 × 5 （P18564） MAGNESIUM ION × 5 CALCIUM ION × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	O1 Manisa VP1 × 6 （Q6PMW3） O1 Manisa VP2 × 6 （Q6PMW3） Capsid protein × 6 （A0A1C6ZW60） O1 Manisa VP4 × 6 （E1ACS1） Integrin beta-6 × 6 （P18564） MAGNESIUM ION × 6 CALCIUM ION × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	O1 Manisa VP1 × 1 （Q6PMW3） O1 Manisa VP2 × 1 （Q6PMW3） Capsid protein × 1 （A0A1C6ZW60） O1 Manisa VP4 × 1 （E1ACS1） Integrin beta-6 × 1 （P18564） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ITAV_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–590； UniProt 31–624

Integrin beta-6

Homo sapiens

UniProt P18564

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	O1 Manisa VP1 × 60 （Q6PMW3） O1 Manisa VP2 × 60 （Q6PMW3） Capsid protein × 60 （A0A1C6ZW60） O1 Manisa VP4 × 60 （E1ACS1） Integrin alpha-V × 60 （P06756） MAGNESIUM ION × 60 CALCIUM ION × 120	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	O1 Manisa VP1 × 1 （Q6PMW3） O1 Manisa VP2 × 1 （Q6PMW3） Capsid protein × 1 （A0A1C6ZW60） O1 Manisa VP4 × 1 （E1ACS1） Integrin alpha-V × 1 （P06756） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	O1 Manisa VP1 × 5 （Q6PMW3） O1 Manisa VP2 × 5 （Q6PMW3） Capsid protein × 5 （A0A1C6ZW60） O1 Manisa VP4 × 5 （E1ACS1） Integrin alpha-V × 5 （P06756） MAGNESIUM ION × 5 CALCIUM ION × 10	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	O1 Manisa VP1 × 6 （Q6PMW3） O1 Manisa VP2 × 6 （Q6PMW3） Capsid protein × 6 （A0A1C6ZW60） O1 Manisa VP4 × 6 （E1ACS1） Integrin alpha-V × 6 （P06756） MAGNESIUM ION × 6 CALCIUM ION × 12	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	O1 Manisa VP1 × 1 （Q6PMW3） O1 Manisa VP2 × 1 （Q6PMW3） Capsid protein × 1 （A0A1C6ZW60） O1 Manisa VP4 × 1 （E1ACS1） Integrin alpha-V × 1 （P06756） MAGNESIUM ION × 1 CALCIUM ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ITB6_HUMAN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B； PDBConstruct 1–470； UniProt 22–491

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5neu
Deposition date deposition_date	2017-03-11
Structure title title	Localised Reconstruction of Integrin alpha V beta 6 bound to Foot and Mouth Disease Virus O1 Manisa - Pose B.
Keywords keywords	Foot and Mouth Disease Virus, FMDV, virus, OpanAsia, virus-receptor, complex; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5neu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5neu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5neu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	602.60 Å
Total Rg	603.00 Å
Atom count	797220
Residues	103080
Excluded volume	14145000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5neu__assembly_1__model_1`	360-meric （360）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5neu__assembly_2__model_1`	hexameric （6）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`5neu__assembly_3__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`5neu__assembly_4__model_1`	36-meric （36）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`5neu__assembly_5__model_1`	hexameric （6）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	O1 Manisa VP1
Molecular weight formula_weight	22850.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	13287

TTSAGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQTPAHTLVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPEAALDNTTNPTAYHKAPLTRLALPYTAPHRVLATVYNGNSKYGDGTVANVRGDLQVLAQKAARALPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIHPDQARHKQKIVAP

Source Source

Source organism organism	Foot-and-mouth disease virus
NCBI taxonomy ID ncbi_taxonomy_id	12110
Host organism host_organism	Cricetinae gen. sp.

Entity 2 Entity 2 polymer

Description description	O1 Manisa VP2
Molecular weight formula_weight	24417.5 kDa
Mutation mutation	S93Y
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

DKKTEETTLLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVAQAERFFKTHLFDWVTSDPFGRCHLLELPTDHKGVYGYLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIQKRELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNSEGAPQIKVYANIAPTNVHVAGEFPSKE

Source Source

Source organism organism	Foot-and-mouth disease virus
NCBI taxonomy ID ncbi_taxonomy_id	12110
Host organism host_organism	Cricetinae gen. sp.

Entity 3 Entity 3 polymer

Description description	Capsid protein
Molecular weight formula_weight	23933.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GIFPVACSDGYGGLVTTDPKTADPAYGKVFNPPRNMLPGRFTNFLDVAEACPTFLHFEGDVPYVTTKTDSDRVLAQFDLSLAAKHMSNTFLAGLAQYYTQYSGTINLHFMFTGPTDAKARYMIAYAPPGMEPPKTPEAAAHCIHAEWDTGLNSKFTFSIPYLSAADYTYTASDVAETTNVQGWVCLFQITHGKADGDALVVLASAGKDFELRLPVDARTQ

Source Source

Source organism organism	Foot-and-mouth disease virus
NCBI taxonomy ID ncbi_taxonomy_id	12110
Host organism host_organism	Cricetinae gen. sp.

Entity 4 Entity 4 polymer

Description description	O1 Manisa VP4
Molecular weight formula_weight	8766.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAGQSSPATGSQNQSGNTGSIINNYYMQQYQNSMDTQLGDNATSGGSNEGSTDTTSTHTTNTQNNDWFSKLASSAFSGLFGALLA

Source Source

Source organism organism	Foot-and-mouth disease virus
NCBI taxonomy ID ncbi_taxonomy_id	12110
Host organism host_organism	Cricetinae gen. sp.

Entity 5 Entity 5 polymer

Description description	Integrin alpha-V
Molecular weight formula_weight	64937.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

FNLDVDSPAEYSGPEGSYFGFAVDFFVPSSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSCPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	Integrin beta-6
Molecular weight formula_weight	51534.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHNGNGSFQCGVCACHPGHMGPRCE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d5neu1_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

Domain ID domain_id	d5neu3_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

Domain ID domain_id	d5neua1
Class class	b — All beta proteins
Fold Fold fold	b.69 — 7-bladed beta-propeller
Superfamily Superfamily superfamily	b.69.8 — Integrin alpha N-terminal domain
Family Family family	b.69.8.1 — Integrin alpha N-terminal domain

Domain ID domain_id	d5neua2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.15 — Integrin domains
Family Family family	b.1.15.0 — automated matches

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	12.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	13483

Localised Reconstruction of Integrin alpha V beta 6 bound to Foot and Mouth Disease Virus O1 Manisa - Pose B.

1. Protein Identity and Related Structures Protein Identity & Related Structures

O1 Manisa VP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

O1 Manisa VP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Integrin alpha-V

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Integrin beta-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5neu__assembly_1__model_1

5neu__assembly_1__model_1 | I(q)

5neu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (4 domains)

7. Citations (1)