SAXSdb — 5tqb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

60S ribosomal protein L4-like protein

Chaetomium thermophilum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Assembly chaperone of ribosomal protein L4 (Acl4) × 1 （G0S0I4） 1,2-ETHANEDIOL × 8 DI(HYDROXYETHYL)ETHER × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SFC3_CHATD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–277； UniProt 1–277

Assembly chaperone of ribosomal protein L4 (Acl4)

Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)

UniProt G0S0I4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	60S ribosomal protein L4-like protein × 1 （G0SFC3） 1,2-ETHANEDIOL × 8 DI(HYDROXYETHYL)ETHER × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S0I4_CHATD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–335； UniProt 27–361

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5tqb
Deposition date deposition_date	2016-10-23
Structure title title	Crystal structure of assembly chaperone of ribosomal protein L4 (Acl4) in complex with ribosomal protein L4 (RpL4)
Keywords keywords	Ribosome Assembly Chaperone, Ribosomal Protein; RIBOSOMAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5tqb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5tqb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5tqb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.66 Å
Rg (electron density)	25.65 Å
Total Rg	26.52 Å
Atom count	9095
Residues	572
Excluded volume	80623 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5tqb__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	60S ribosomal protein L4-like protein
Molecular weight formula_weight	29941.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	9167

MASRPTVTVFGADGKPTGATEVLPKVFSAPIRPDIVKHVHTGMAKNKRQPYAVSEKAGHQTSAESWGTGRAVARIPRVSGGGTHRAGQGAFGNMCRSGRMFAPTKIWRKWHVKINQGQKRFATASALAASAVAPLLMARGHQVSTVPEVPLVVDSAAVAGDAVAKTAAAYKLLKAIGAGPDVEKVKKSKKLRAGKGKMRGRRHRQRRGPLIVYSPEHDGKELVKGFRNIPGVETCPVDALNLLQLAPGGHLGRFIVWTSAAIKQLDAVYESKKGFFL

Source Source

Source organism organism	Chaetomium thermophilum
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Assembly chaperone of ribosomal protein L4 (Acl4)
Molecular weight formula_weight	37937.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

SINPKELLDRATTLLEEGDIETAAKVARTAYEHIGENGRHAGAALTLLGQIHVELGDIDAARNYYAAAVKVDEDGSLPEELGGGPEKFLWLAQLSEEGGHDSVAWFERGATVLRAQIQSLMDSLEQRPLSRGQVEAAIADKRRRLAETLCAVVEVYMTDLSWEDDAEQRCEALITEATMIAPEWPETWQTVANVRISQERTEEAREALRRSLGLWTHLPPEDPGVPPFPSRVSLVRLLIEVDMEEEALEVTERLIAEDDLSVEVWYLGGYARYRLGEKEREASGQASEPEAWKDTWRSSRKWLRQCLKVFEAEEYEDERLGEHAKELIASIIGEL

Source Source

Source organism organism	Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
NCBI taxonomy ID ncbi_taxonomy_id	759272
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	56

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	5tqbB01
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

▶

Unit-cell length a length_a	121.000 Å
Unit-cell length b length_b	127.900 Å
Unit-cell length c length_c	42.700 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	43.949 Å
R factor r_factor	0.1909
R_work r_work	0.1891
R_free r_free	0.2247

Crystal structure of assembly chaperone of ribosomal protein L4 (Acl4) in complex with ribosomal protein L4 (RpL4)

1. Protein Identity and Related Structures Protein Identity & Related Structures

60S ribosomal protein L4-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Assembly chaperone of ribosomal protein L4 (Acl4)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5tqb__assembly_1__model_1

5tqb__assembly_1__model_1 | I(q)

5tqb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)

Crystal structure of assembly chaperone of ribosomal protein L4 (Acl4) in complex with ribosomal protein L4 (RpL4)

1. Protein Identity and Related Structures Protein Identity & Related Structures

60S ribosomal protein L4-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Assembly chaperone of ribosomal protein L4 (Acl4)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5tqb__assembly_1__model_1

5tqb__assembly_1__model_1 | I(q)

5tqb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)