SAXSdb — 5vu2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 envelope glycoprotein

Chikungunya virus strain Senegal 37997

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1440	E3 envelope glycoprotein × 240 （C7S7A1） capsid protein × 240 （Q5XXP3） E1 envelope glycoprotein × 240 （Q5XXP3） E2 envelope glycoprotein × 240 （Q5XXP3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 24	E3 envelope glycoprotein × 4 （C7S7A1） capsid protein × 4 （Q5XXP3） E1 envelope glycoprotein × 4 （Q5XXP3） E2 envelope glycoprotein × 4 （Q5XXP3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 120	E3 envelope glycoprotein × 20 （C7S7A1） capsid protein × 20 （Q5XXP3） E1 envelope glycoprotein × 20 （Q5XXP3） E2 envelope glycoprotein × 20 （Q5XXP3）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 144	E3 envelope glycoprotein × 24 （C7S7A1） capsid protein × 24 （Q5XXP3） E1 envelope glycoprotein × 24 （Q5XXP3） E2 envelope glycoprotein × 24 （Q5XXP3）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 24	E3 envelope glycoprotein × 4 （C7S7A1） capsid protein × 4 （Q5XXP3） E1 envelope glycoprotein × 4 （Q5XXP3） E2 envelope glycoprotein × 4 （Q5XXP3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H4CWF2_CHIKV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–866； UniProt 326–1191 Author chain B； PDBConstruct 1–866； UniProt 326–1191 Author chain C； PDBConstruct 1–866； UniProt 326–1191 Author chain D； PDBConstruct 1–866； UniProt 326–1191 Author chain M； PDBConstruct 1–866； UniProt 326–1191 Author chain N； PDBConstruct 1–866； UniProt 326–1191 Author chain O； PDBConstruct 1–866； UniProt 326–1191 Author chain P； PDBConstruct 1–866； UniProt 326–1191

E3 envelope glycoprotein

Chikungunya virus strain Senegal 37997

UniProt C7S7A1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1440	E1 envelope glycoprotein × 480 （A0A0H4CWF2） capsid protein × 240 （Q5XXP3） E1 envelope glycoprotein × 240 （Q5XXP3） E2 envelope glycoprotein × 240 （Q5XXP3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 24	E1 envelope glycoprotein × 8 （A0A0H4CWF2） capsid protein × 4 （Q5XXP3） E1 envelope glycoprotein × 4 （Q5XXP3） E2 envelope glycoprotein × 4 （Q5XXP3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 120	E1 envelope glycoprotein × 40 （A0A0H4CWF2） capsid protein × 20 （Q5XXP3） E1 envelope glycoprotein × 20 （Q5XXP3） E2 envelope glycoprotein × 20 （Q5XXP3）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 144	E1 envelope glycoprotein × 48 （A0A0H4CWF2） capsid protein × 24 （Q5XXP3） E1 envelope glycoprotein × 24 （Q5XXP3） E2 envelope glycoprotein × 24 （Q5XXP3）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 24	E1 envelope glycoprotein × 8 （A0A0H4CWF2） capsid protein × 4 （Q5XXP3） E1 envelope glycoprotein × 4 （Q5XXP3） E2 envelope glycoprotein × 4 （Q5XXP3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C7S7A1_CHIKV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain U； PDBConstruct 1–59； UniProt 266–324 Author chain V； PDBConstruct 1–59； UniProt 266–324 Author chain W； PDBConstruct 1–59； UniProt 266–324 Author chain X； PDBConstruct 1–59； UniProt 266–324

capsid protein

Chikungunya virus (strain 37997)

UniProt Q5XXP3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 1440	E1 envelope glycoprotein × 480 （A0A0H4CWF2） E3 envelope glycoprotein × 240 （C7S7A1）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 24	E1 envelope glycoprotein × 8 （A0A0H4CWF2） E3 envelope glycoprotein × 4 （C7S7A1）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 120	E1 envelope glycoprotein × 40 （A0A0H4CWF2） E3 envelope glycoprotein × 20 （C7S7A1）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 144	E1 envelope glycoprotein × 48 （A0A0H4CWF2） E3 envelope glycoprotein × 24 （C7S7A1）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 24	E1 envelope glycoprotein × 8 （A0A0H4CWF2） E3 envelope glycoprotein × 4 （C7S7A1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLS_CHIK3
Isoform	—
PDB entities	3, 4, 5
Chains and sequence ranges	Author chain I； PDBConstruct 1–149； UniProt 113–261 Author chain J； PDBConstruct 1–149； UniProt 113–261 Author chain K； PDBConstruct 1–149； UniProt 113–261 Author chain L； PDBConstruct 1–149； UniProt 113–261 Author chain E； PDBConstruct 1–46； UniProt 1203–1248 Author chain F； PDBConstruct 1–46； UniProt 1203–1248 Author chain G； PDBConstruct 1–46； UniProt 1203–1248 Author chain H； PDBConstruct 1–46； UniProt 1203–1248 Author chain Q； PDBConstruct 1–81； UniProt 668–748 Author chain R； PDBConstruct 1–81； UniProt 668–748 Author chain S； PDBConstruct 1–81； UniProt 668–748 Author chain T； PDBConstruct 1–81； UniProt 668–748

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5vu2
Deposition date deposition_date	2017-05-18
Structure title title	Electron cryo-microscopy of "immature" Chikungunya VLP
Keywords keywords	Chikungunya, virus, immature, VIRUS LIKE PARTICLE; VIRUS LIKE PARTICLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5vu2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5vu2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5vu2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	271.50 Å
Total Rg	271.60 Å
Atom count	1959120
Residues	254160
Excluded volume	34805000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5vu2__assembly_1__model_1`	1440-meric （1440）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`5vu2__assembly_2__model_1`	24-meric （24）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`5vu2__assembly_3__model_1`	120-meric （120）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`5vu2__assembly_4__model_1`	144-meric （144）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`5vu2__assembly_5__model_1`	24-meric （24）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	E1 envelope glycoprotein
Molecular weight formula_weight	95538.2 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,A,B,N,C,O,D,P
Atom count atom_count	32676

STKDNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQLSTNGTAHGHPHEIILYYYELYPTMTVVVVSVATFILLSMVGMAAGMCMCARRRCITPYELTPGATVPFLLSLICCIRTAKAATYQEAAIYLWNEQQPLFWLQALIPLAALIVLCNCLRLLPCCCKTLAFLAVMSVGAHTVSAYEHVTVIPNTVGVPYKTLVNRPGYSPMVLEMELLSVTLEPTLSLDYITCEYKTVIPSPYVKCCGTAECKDKNLPDYSCKVFTGVYPFMWGGAYCFCDAENTQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNITVTAYANGDHAVTVKDAKFIVGPMSSAWTPFDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPESKDVYANTQLVLQRPAAGTVHVPYSQAPSGFKYWLKERGASLQHTAPFGCQIATNPVRAVNCAVGNMPISIDIPEAAFTRVVDAPSLTDMSCEVPACTHSSDFGGVAIIKYAASKKGKCAVHSMTNAVTIREAEIEVEGNSQLQISFSTALASAEFRVQVCSTQVHCAAECHP

Source Source

Source organism organism	Chikungunya virus strain Senegal 37997
Common name common_name	CHIKV
NCBI taxonomy ID ncbi_taxonomy_id	371095
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	E3 envelope glycoprotein
Molecular weight formula_weight	6927.0 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U,V,W,X

PVMCLLANTTFPCSQPPCTPCCYEKEPEETLRMLEDNVMRPGYYQLLQASLTCSPHRQRE

Source Source

Source organism organism	Chikungunya virus strain Senegal 37997
Common name common_name	CHIKV
NCBI taxonomy ID ncbi_taxonomy_id	371095
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	capsid protein
Molecular weight formula_weight	16229.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L

CIFEVKHEGKVMGYACLVGDKVMKPAHVKGTIDNADLAKLAFKRSSKYDLECAQIPVHMKSDASKFTHEKPEGYYNWHHGAVQYSGGRFTIPTGAGKPGDSGRPIFDNKGRVVAIVLGGANEGARTALSVVTWNKDIVTKITPEGAEEW

Source Source

Source organism organism	Chikungunya virus (strain 37997)
Common name common_name	CHIKV
NCBI taxonomy ID ncbi_taxonomy_id	371095
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	E1 envelope glycoprotein
Molecular weight formula_weight	4810.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

HTTLGVQDISTTAMSWVQKITGGVGLIVAVAALILIVVLCVSFSRH

Source Source

Source organism organism	Chikungunya virus strain Senegal 37997
Common name common_name	CHIKV
NCBI taxonomy ID ncbi_taxonomy_id	371095
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	E2 envelope glycoprotein
Molecular weight formula_weight	8817.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,R,S,T

STNGTAHGHPHEIILYYYELYPTMTVVIVSVASFVLLSMVGTAVGMCVCARRRCITPYELTPGATVPFLLSLLCCVRTTKA

Source Source

Source organism organism	Chikungunya virus strain Senegal 37997
Common name common_name	CHIKV
NCBI taxonomy ID ncbi_taxonomy_id	371095
Host organism host_organism	Homo sapiens

▶

Resolution resolution	6.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	72944

Electron cryo-microscopy of "immature" Chikungunya VLP

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

E3 envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5vu2__assembly_1__model_1

5vu2__assembly_1__model_1 | I(q)

5vu2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)

Electron cryo-microscopy of "immature" Chikungunya VLP

1. Protein Identity and Related Structures Protein Identity & Related Structures

E1 envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

E3 envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5vu2__assembly_1__model_1

5vu2__assembly_1__model_1 | I(q)

5vu2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

7. Citations (1)