SAXSdb — 5w7g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ORF140

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 42 DNA 2	ORF132 × 21 （Q70LC7） DNA (253-MER) × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y140_AFV1Y
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–140； UniProt 1–140 Author chain C； PDBConstruct 1–140； UniProt 1–140 Author chain E； PDBConstruct 1–140； UniProt 1–140 Author chain G； PDBConstruct 1–140； UniProt 1–140 Author chain I； PDBConstruct 1–140； UniProt 1–140 Author chain K； PDBConstruct 1–140； UniProt 1–140 Author chain M； PDBConstruct 1–140； UniProt 1–140 Author chain O； PDBConstruct 1–140； UniProt 1–140 Author chain Q； PDBConstruct 1–140； UniProt 1–140 Author chain S； PDBConstruct 1–140； UniProt 1–140 Author chain U； PDBConstruct 1–140； UniProt 1–140 Author chain W； PDBConstruct 1–140； UniProt 1–140 Author chain Y； PDBConstruct 1–140； UniProt 1–140 Author chain a； PDBConstruct 1–140； UniProt 1–140 Author chain c； PDBConstruct 1–140； UniProt 1–140 Author chain e； PDBConstruct 1–140； UniProt 1–140 Author chain g； PDBConstruct 1–140； UniProt 1–140 Author chain i； PDBConstruct 1–140； UniProt 1–140 Author chain k； PDBConstruct 1–140； UniProt 1–140 Author chain m； PDBConstruct 1–140； UniProt 1–140 Author chain o； PDBConstruct 1–140； UniProt 1–140

ORF132

OrganismNot specified

UniProt Q70LC7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 42 DNA 2	ORF140 × 21 （Q70LC6） DNA (253-MER) × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Y132_AFV1Y
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–132； UniProt 1–132 Author chain D； PDBConstruct 1–132； UniProt 1–132 Author chain F； PDBConstruct 1–132； UniProt 1–132 Author chain H； PDBConstruct 1–132； UniProt 1–132 Author chain J； PDBConstruct 1–132； UniProt 1–132 Author chain L； PDBConstruct 1–132； UniProt 1–132 Author chain N； PDBConstruct 1–132； UniProt 1–132 Author chain P； PDBConstruct 1–132； UniProt 1–132 Author chain R； PDBConstruct 1–132； UniProt 1–132 Author chain T； PDBConstruct 1–132； UniProt 1–132 Author chain V； PDBConstruct 1–132； UniProt 1–132 Author chain X； PDBConstruct 1–132； UniProt 1–132 Author chain Z； PDBConstruct 1–132； UniProt 1–132 Author chain b； PDBConstruct 1–132； UniProt 1–132 Author chain d； PDBConstruct 1–132； UniProt 1–132 Author chain f； PDBConstruct 1–132； UniProt 1–132 Author chain h； PDBConstruct 1–132； UniProt 1–132 Author chain j； PDBConstruct 1–132； UniProt 1–132 Author chain l； PDBConstruct 1–132； UniProt 1–132 Author chain n； PDBConstruct 1–132； UniProt 1–132 Author chain p； PDBConstruct 1–132； UniProt 1–132

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5w7g
Deposition date deposition_date	2017-06-19
Structure title title	An envelope of a filamentous hyperthermophilic virus carries lipids in a horseshoe conformation
Keywords keywords	AFV1, hyperthermophile, filamentous virus, A-form DNA, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5w7g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5w7g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5w7g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.92 Å
Rg (electron density)	57.03 Å
Total Rg	57.14 Å
Atom count	53508
Residues	5901
Excluded volume	923090 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5w7g__assembly_1__model_1`	44-meric （44）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	ORF140
Molecular weight formula_weight	15832.9 kDa
Source method src_method	nat
Copy count entity_count	21

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O,Q,S,U,W,Y,a,c,e,g,i,k,m,o
Atom count atom_count	53508

MAKLNRKLRQDSTDRYKTKLYLWRNLGGLIPEDMAISVTESITADWKQYNDMMSKVRNETLDILKTNKVATEDYIGYIAFAEELAHQVWKNKNSSPDPNTANEASKTDLESKYSDVYGLDVTVLDAIYNAVIPIIMGGGS

Entity 2 Entity 2 polymer

Description description	ORF132
Molecular weight formula_weight	15017.2 kDa
Source method src_method	nat
Copy count entity_count	21

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P,R,T,V,X,Z,b,d,f,h,j,l,n,p

MVNKKYRQDSKDRYQYKQYIYRSIGGIVPPEMAETVTANQTAQWEAGFTPYHKLRLAIKEICKTDGIPNIKWGMYIAFGEKLLKSYLKMKAGSASSDMIAEYINNAISAFSSRTGISQETAQKIADFITSNY

Entity 3 Entity 3 polymer

Description description	DNA (253-MER)
Molecular weight formula_weight	77747.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	q,r

ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT

▶

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	119495

An envelope of a filamentous hyperthermophilic virus carries lipids in a horseshoe conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

ORF140

State in the Current Structure

Other States of the Same Protein in the Database

ORF132

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5w7g__assembly_1__model_1

5w7g__assembly_1__model_1 | I(q)

5w7g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

An envelope of a filamentous hyperthermophilic virus carries lipids in a horseshoe conformation

1. Protein Identity and Related Structures Protein Identity & Related Structures

ORF140

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF132

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

5w7g__assembly_1__model_1

5w7g__assembly_1__model_1 | I(q)

5w7g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)