5xnl

Structure of stacked C2S2M2-type PSII-LHCII supercomplex from Pisum sativum

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein 8, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB28_PEA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–232； UniProt 37–268 Author chain 2； PDBConstruct 1–232； UniProt 37–268 Author chain 5； PDBConstruct 1–232； UniProt 37–268 Author chain 6； PDBConstruct 1–232； UniProt 37–268 Author chain G； PDBConstruct 1–232； UniProt 37–268 Author chain N； PDBConstruct 1–232； UniProt 37–268 Author chain Y； PDBConstruct 1–232； UniProt 37–268 Author chain g； PDBConstruct 1–232； UniProt 37–268 Author chain n； PDBConstruct 1–232； UniProt 37–268 Author chain y； PDBConstruct 1–232； UniProt 37–268

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt Q04918

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q04918_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 3； PDBConstruct 1–243； UniProt 23–265 Author chain 7； PDBConstruct 1–243； UniProt 23–265

Photosystem II protein D1

OrganismNot specified

UniProt P06585

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_PEA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–344； UniProt 1–344 Author chain a； PDBConstruct 1–344； UniProt 1–344

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt Q9XQR6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9XQR6_PEA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–507； UniProt 1–507 Author chain b； PDBConstruct 1–507； UniProt 1–507

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt P06004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_PEA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–473； UniProt 1–473 Author chain c； PDBConstruct 1–473； UniProt 1–473

Photosystem II D2 protein

OrganismNot specified

UniProt P06006

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_PEA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D； PDBConstruct 1–353； UniProt 1–353 Author chain d； PDBConstruct 1–353； UniProt 1–353

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P13554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_PEA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–83； UniProt 1–83 Author chain e； PDBConstruct 1–83； UniProt 1–83

Photosystem II reaction center protein H

OrganismNot specified

UniProt Q9XQR3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_PEA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–73； UniProt 1–73 Author chain h； PDBConstruct 1–73； UniProt 1–73

Photosystem II reaction center protein J

OrganismNot specified

UniProt P13555

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBJ_PEA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40 Author chain j； PDBConstruct 1–40； UniProt 1–40

Photosystem II reaction center protein K

OrganismNot specified

UniProt D5MAJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5MAJ8_PEA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain K； PDBConstruct 1–61； UniProt 1–61 Author chain k； PDBConstruct 1–61； UniProt 1–61

Photosystem II reaction center protein L

OrganismNot specified

UniProt P60147

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_PEA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain L； PDBConstruct 1–38； UniProt 1–38 Author chain l； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein M

OrganismNot specified

UniProt P69529

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_PEA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain M； PDBConstruct 1–34； UniProt 1–34 Author chain m； PDBConstruct 1–34； UniProt 1–34

Oxygen-evolving enhancer protein 1, chloroplastic

OrganismNot specified

UniProt P14226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO_PEA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain O； PDBConstruct 1–248； UniProt 82–329 Author chain o； PDBConstruct 1–248； UniProt 82–329

Oxygen-evolving enhancer protein 2, chloroplastic

OrganismNot specified

UniProt P16059

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBP_PEA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain P； PDBConstruct 1–186； UniProt 74–259 Author chain p； PDBConstruct 1–186； UniProt 74–259

Oxygen-evolving enhancer protein 3

OrganismNot specified

UniProt Q7Y1T5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q7Y1T5_PEA
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Q； PDBConstruct 1–148； UniProt 87–234 Author chain q； PDBConstruct 1–148； UniProt 87–234

Photosystem II reaction center protein T

OrganismNot specified

UniProt Q8HS25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_PEA
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain T； PDBConstruct 1–35； UniProt 1–35 Author chain t； PDBConstruct 1–35； UniProt 1–35

Photosystem II reaction center protein X

OrganismNot specified

UniProt Q8VYY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein Z × 2 （Q32902） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8VYY1_PEA
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain X； PDBConstruct 1–86； UniProt 1–86 Author chain x； PDBConstruct 1–86； UniProt 1–86

Photosystem II reaction center protein Z

OrganismNot specified

UniProt Q32902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 56	Chlorophyll a-b binding protein 8, chloroplastic × 10 （P27490） Chlorophyll a-b binding protein, chloroplastic × 2 （Q04918） Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24 × 2 Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta, PsbF × 2 Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I, PsbI × 2 Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Oxygen-evolving enhancer protein 2, chloroplastic × 2 （P16059） Oxygen-evolving enhancer protein 3 × 2 （Q7Y1T5） Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 Photosystem II reaction center protein X × 2 （Q8VYY1） CHLOROPHYLL B × 98 CHLOROPHYLL A × 216 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 32 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 16 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 16 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 36 BETA-CAROTENE × 24 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 BICARBONATE ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 2 water × 44	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_PEA
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5xnl
Deposition date deposition_date	2017-05-23
Structure title title	Structure of stacked C2S2M2-type PSII-LHCII supercomplex from Pisum sativum
Keywords keywords	Photosystem II, PSII-LHCII, C2S2M2, Supercomplex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5xnl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5xnl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5xnl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	84.08 Å
Rg (electron density)	85.05 Å
Total Rg	84.29 Å
Atom count	97910
Residues	9364
Excluded volume	1820100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5xnl__assembly_1__model_1`	56-meric （56）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (42)

Entity 1 Entity 1 polymer

Description description	Chlorophyll a-b binding protein 8, chloroplastic
Molecular weight formula_weight	24952.1 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,G,N,Y,5,6,g,n,y
Atom count atom_count	98986

RKSATTKKVASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK

Entity 2 Entity 2 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	26545.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,7

RKSANPLRDVVAMGTSKFTMGNDLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFAKNRALEVIHGRWAMLGALGCITPEVLQKWVRVDFKEPVWFKAGSQIFSEGGLDYLGNPNLVHAQSILAVLGFQIVLMGLVEGFRINGLPDVGEGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLLDHLDNPVANNAWVYATKFVPGA

Entity 3 Entity 3 polymer

Description description	Light harvesting chlorophyll a/b-binding protein Lhcb6, CP24
Molecular weight formula_weight	22859.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,8

AASAPKKSWIPGVSFGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGVPWFEAGADPNAIAPFSFGTLLGTQLILMGWVESKRWVDFFNPDSQSVEWATPWSKTAENFVNSTGEQGYPGGKFFDPLSLAGTIENGVYIPDTDKLERLKLAEIKHARLAMLAMLIFYFEAGQGKTPLGALGL

Entity 4 Entity 4 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	38147.4 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a

MTAILERRDSENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Entity 5 Entity 5 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	56117.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,b

MGLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGTITNPGIWSYEGVAAAHIVFSGLCFLAAIWHWLYWDLEIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLFGPGIWVSDPYGLTGRVQSVNPAWGVDGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGHVENQSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMPTFFETFPVVLVDGDGIVRGDVPFRRAESKYSVEQVGVIVEFYGGELNGVTYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDLFAGIDPDLDAQVEFGAFQKLGDPTTRRGL

Entity 6 Entity 6 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	52035.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c

MKTLYSLRRFYHVETLFNGTLALTGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGSFLLVFKAFYFGGIYDTWAPGGGDVRKITNFTLSPSILFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILTKPFAWARRALVWSGEAYLSYSLGALAVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN

Entity 7 Entity 7 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39557.2 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d

MTIALGKFTKDQNDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDLTRWCQLGGLWTFVALHGAFGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMATQDQPHENLIFPEEVLPRGNAL

Entity 8 Entity 8 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9421.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e

MSGSTGERSFADIITSIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTETRQGIPLITGRFDSLEQLDEFSRSF

Entity 9 Entity 9 polymer

Description description	Cytochrome b559 subunit beta, PsbF
Molecular weight formula_weight	4488.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f

MTIDRTYPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQR

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7863.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h

MATQTVENSSRSGPRRTAVGDLLKPLNSEYGKVAPGWGTTPLMGIAMALFAVFLSIILEIYNSSLLLDQISMN

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein I, PsbI
Molecular weight formula_weight	4184.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i

MLTLKLFVYTIVIFFVSLFIFGFLSNDPGRNPGREE

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein J
Molecular weight formula_weight	4116.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j

MANTTGRIPLWIIGTVAGIVVIGLIGLFFYGSYSGLGSSL

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	6912.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k

MLNIFSLVCICINSALYSSSFFLGKLPEAYAFLNPIVDFMPVIPLLFFLLAFVWQAAVSFR

Entity 14 Entity 14 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4498.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l

MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN

Entity 15 Entity 15 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3756.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m

MEVNILAFIATALFILVPTAFLLIIYVKTVSQSD

Entity 16 Entity 16 polymer

Description description	Oxygen-evolving enhancer protein 1, chloroplastic
Molecular weight formula_weight	26554.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,o

EGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLES

Entity 17 Entity 17 polymer

Description description	Oxygen-evolving enhancer protein 2, chloroplastic
Molecular weight formula_weight	20287.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,p

AYGEAANVFGKAKTNTDYLPYNGDGFKLLVPAKWNPSKEREFPGQVLRYEDNFDATSNVSVLVQTTDKKSITDYGSPEEFLSKVDYLLGKQAFFGQTDSEGGFDTNAVAVANILESSAPVIGGKQYYNISVLTRTADGDEGGKHQLITATVKDGKLYICKAQAGDKRWFKGARKFVEDTASSFSVA

Entity 18 Entity 18 polymer

Description description	Oxygen-evolving enhancer protein 3
Molecular weight formula_weight	16398.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q,q

EAIPIKVGGPPPLSGGLPGTLNSDEARDLKLPLKERFFIQPLAPTEAAARTKESAKEIVAAKKFIDQKAWPFLQNDLRLRAGYLRYDLKTIISSKPKDQKQSLKELTDKLFQDISNLDHAAKIKSPSEAEKYYAIAVSTLNDVLSKIA

Entity 19 Entity 19 polymer

Description description	Light harvesting chlorophyll a/b-binding protein Lhcb4, CP29
Molecular weight formula_weight	27138.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,r

KPSRSAPTTDRPLWFPGAKSPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLAGDVIGTRTEFEDVKSTPFQPYTEVFGLQRFRECELIHGRWAMLATLGALTVEWLTGVTWQDAGKVELVEGSTYLGQPLPFSITTLIWIEVLVIGYIEFQRNAELDSEKRLYPGGKFFDPLGLAADPEKKATLQLAEIKHARLAMVAFLGFAVQAAATGKGPLNNWATHLSDPLHTTIIDTFSSS

Entity 20 Entity 20 polymer

Description description	Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26
Molecular weight formula_weight	26541.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,s

ALFSKKKAAPPKKAVVSPVDDELAKWYGPDRRIFLPEGLLDRSEIPAYLTGEVPGDYGYDPFGLSKKPDDFAKYQAYELIHGRWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLIFAVIAEVVLVGGAEYYRIINGLNLEDKLHPGGPFDPLGLAKDPDQAAILKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFANNLLTVLAGSAERAPTL

Entity 21 Entity 21 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	4036.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,t

MEALVYTFLLVSTLGIIFFAIFFREPPKVPTKNTK

Entity 22 Entity 22 polymer

Description description	Photosystem II reaction center protein W
Molecular weight formula_weight	5914.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,w

LVDDRMSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFIYASGLDEDEESGLSL

Entity 23 Entity 23 polymer

Description description	Photosystem II reaction center protein X
Molecular weight formula_weight	8692.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,x

SIGRASSKSNGRFQVKASLKEKVVTGLTAAALTAQMVIPDVAEAATVSPSLKNFLLSIVSGGVVVTAILGAVIGVSNFDPVKRGSQ

Entity 24 Entity 24 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6555.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,z

MTIAFQLAVFALIVTSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS

Entity 25 Entity 25 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	98

Entity 26 Entity 26 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	216

Entity 27 Entity 27 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	32

Entity 28 Entity 28 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 29 Entity 29 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 30 Entity 30 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	36

Entity 31 Entity 31 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 32 Entity 32 non-polymer

Description description	CA-MN4-O5 CLUSTER
Molecular weight formula_weight	339.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 33 Entity 33 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 34 Entity 34 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 35 Entity 35 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 36 Entity 36 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 37 Entity 37 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 38 Entity 38 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 39 Entity 39 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 40 Entity 40 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 41 Entity 41 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 42 Entity 42 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1076

▼

6. Fold Classification (SCOP + CATH) 42 domains

SCOP 2.08 (22 domains)

Domain ID domain_id	d5xnl1_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnl2_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnl3_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnl5_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnl6_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnl7_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnla_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.26 — Bacterial photosystem II reaction centre, L and M subunits
Superfamily Superfamily superfamily	f.26.1 — Bacterial photosystem II reaction centre, L and M subunits
Family Family family	f.26.1.1 — Bacterial photosystem II reaction centre, L and M subunits

Domain ID domain_id	d5xnlb_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.55 — Photosystem II antenna protein-like
Superfamily Superfamily superfamily	f.55.1 — Photosystem II antenna protein-like
Family Family family	f.55.1.1 — Photosystem II antenna protein-like

Domain ID domain_id	d5xnlc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.55 — Photosystem II antenna protein-like
Superfamily Superfamily superfamily	f.55.1 — Photosystem II antenna protein-like
Family Family family	f.55.1.1 — Photosystem II antenna protein-like

Domain ID domain_id	d5xnld_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.26 — Bacterial photosystem II reaction centre, L and M subunits
Superfamily Superfamily superfamily	f.26.1 — Bacterial photosystem II reaction centre, L and M subunits
Family Family family	f.26.1.1 — Bacterial photosystem II reaction centre, L and M subunits

Domain ID domain_id	d5xnle_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.38 — Cytochrome b559 subunits
Family Family family	f.23.38.1 — Cytochrome b559 subunits

Domain ID domain_id	d5xnlf_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.38 — Cytochrome b559 subunits
Family Family family	f.23.38.1 — Cytochrome b559 subunits

Domain ID domain_id	d5xnlg_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnlh_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.33 — Photosystem II 10 kDa phosphoprotein PsbH
Family Family family	f.23.33.1 — PsbH-like

Domain ID domain_id	d5xnlk_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.36 — Photosystem II reaction center protein K, PsbK
Family Family family	f.23.36.1 — PsbK-like

Domain ID domain_id	d5xnlm_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.35 — Photosystem II reaction center protein M, PsbM
Family Family family	f.23.35.1 — PsbM-like

Domain ID domain_id	d5xnln_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnlo_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.4 — Transmembrane beta-barrels
Superfamily Superfamily superfamily	f.4.1 — OMPA-like
Family Family family	f.4.1.0 — automated matches

Domain ID domain_id	d5xnlp_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.107 — Mog1p/PsbP-like
Superfamily Superfamily superfamily	d.107.1 — Mog1p/PsbP-like
Family Family family	d.107.1.2 — PsbP-like

Domain ID domain_id	d5xnls_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.0 — automated matches

Domain ID domain_id	d5xnly_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.43 — Chlorophyll a-b binding protein
Superfamily Superfamily superfamily	f.43.1 — Chlorophyll a-b binding protein
Family Family family	f.43.1.1 — Chlorophyll a-b binding protein

Domain ID domain_id	d5xnlz_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.5 — PsbZ-like
Family Family family	f.17.5.0 — automated matches

CATH v4.4 (20 domains)

Domain ID domain_id	5xnl301
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	5xnl701
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	5xnlB02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	680 — Photosystem II CP47 reaction center protein
Homologous superfamily homologous superfamily	10 — Photosystem II CP47 reaction center protein

Domain ID domain_id	5xnlC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	670 — photosystem ii from thermosynechococcus elongatus

Domain ID domain_id	5xnlE00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

Domain ID domain_id	5xnlH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	880 — Photosystem II reaction center protein H

Domain ID domain_id	5xnlP00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1000 — Protein Transport Mog1p; Chain A
Homologous superfamily homologous superfamily	10 — Mog1/PsbP, alpha/beta/alpha sandwich

Domain ID domain_id	5xnlQ00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	290 — Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle

Domain ID domain_id	5xnlS01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	5xnlZ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	740 — Photosystem II PsbZ, reaction centre

Domain ID domain_id	5xnlb02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	680 — Photosystem II CP47 reaction center protein
Homologous superfamily homologous superfamily	10 — Photosystem II CP47 reaction center protein

Domain ID domain_id	5xnlc02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	670 — photosystem ii from thermosynechococcus elongatus

Domain ID domain_id	5xnle00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	860 — Photosystem II cytochrome b559, alpha subunit

Domain ID domain_id	5xnlh01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	880 — Photosystem II reaction center protein H

Domain ID domain_id	5xnlo01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	160 — Porin
Homologous superfamily homologous superfamily	30 — Photosystem II, cytochrome c-550 precursor

Domain ID domain_id	5xnlo02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2050 — photosynthetic oxygen evolving center fold
Homologous superfamily homologous superfamily	10 — photosynthetic oxygen evolving center domain

Domain ID domain_id	5xnlp00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1000 — Protein Transport Mog1p; Chain A
Homologous superfamily homologous superfamily	10 — Mog1/PsbP, alpha/beta/alpha sandwich

Domain ID domain_id	5xnlq00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	290 — Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle

Domain ID domain_id	5xnls01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	5xnlz00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	740 — Photosystem II PsbZ, reaction centre

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	136521

Structure of stacked C2S2M2-type PSII-LHCII supercomplex from Pisum sativum

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein 8, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein K

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer