5xon

RNA Polymerase II elongation complex bound with Spt4/5 and TFIIS

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R4Y0_KOMPG
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1743； UniProt 1–1743

DNA-directed RNA polymerase subunit beta

OrganismNot specified

UniProt C4QZQ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4QZQ7_KOMPG
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1227； UniProt 1–1227

RNA polymerase II third largest subunit B44, part of central core

OrganismNot specified

UniProt C4R7L2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R7L2_KOMPG
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–304； UniProt 1–304

RNA polymerase II subunit B32

OrganismNot specified

UniProt C4R2U9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R2U9_KOMPG
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–186； UniProt 1–186

RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R3P8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R3P8_KOMPG
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–214； UniProt 1–214

RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R1V1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R1V1_KOMPG
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–155； UniProt 1–155

RNA polymerase II subunit

OrganismNot specified

UniProt C4R9A1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R9A1_KOMPG
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–171； UniProt 1–171

RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R273

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R273_KOMPG
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–145； UniProt 1–145

DNA-directed RNA polymerase subunit

OrganismNot specified

UniProt C4QY79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4QY79_KOMPG
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 3–115； UniProt 1–113

RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III

OrganismNot specified

UniProt C4R009

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R009_KOMPG
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–72； UniProt 1–72

RNA polymerase II subunit B12.5

OrganismNot specified

UniProt C4R3Z5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R3Z5_KOMPG
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–118； UniProt 1–118

RNA polymerase subunit, found in RNA polymerase complexes I, II, and III

OrganismNot specified

UniProt C4QWA8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4QWA8_KOMPG
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–72； UniProt 1–72

General transcription elongation factor TFIIS

Komagataella phaffii (strain GS115 / ATCC 20864)

UniProt C4R2R6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 Transcription elongation factor SPT4 × 1 （C4R0E6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R2R6_KOMPG
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain U； PDBConstruct 4–190； UniProt 99–285

Transcription elongation factor SPT4

Komagataella phaffii (strain GS115 / ATCC 20864)

UniProt C4R0E6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Protein that forms a complex with Spt4p × 1 （C4R370） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R0E6_KOMPG
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain V； PDBConstruct 2–108； UniProt 8–114

Protein that forms a complex with Spt4p

Komagataella phaffii (strain GS115 / ATCC 20864)

UniProt C4R370

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 15 DNA 2 RNA 1	DNA-directed RNA polymerase subunit × 1 （C4R4Y0） DNA-directed RNA polymerase subunit beta × 1 （C4QZQ7） RNA polymerase II third largest subunit B44, part of central core × 1 （C4R7L2） RNA polymerase II subunit B32 × 1 （C4R2U9） RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III × 1 （C4R3P8） RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III × 1 （C4R1V1） RNA polymerase II subunit × 1 （C4R9A1） RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III × 1 （C4R273） DNA-directed RNA polymerase subunit × 1 （C4QY79） RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III × 1 （C4R009） RNA polymerase II subunit B12.5 × 1 （C4R3Z5） RNA polymerase subunit, found in RNA polymerase complexes I, II, and III × 1 （C4QWA8） RNA (30-MER) × 1 DNA (48-MER) × 1 DNA (48-MER) × 1 General transcription elongation factor TFIIS × 1 （C4R2R6） Transcription elongation factor SPT4 × 1 （C4R0E6） ZINC ION × 10 MAGNESIUM ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4R370_KOMPG
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain W； PDBConstruct 3–612； UniProt 206–815

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	5xon
Deposition date deposition_date	2017-05-29
Structure title title	RNA Polymerase II elongation complex bound with Spt4/5 and TFIIS
Keywords keywords	transcription, complex, TRANSCRIPTION-RNA complex; TRANSCRIPTION/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

5xon__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

5xon__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

5xon__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.08 Å
Rg (electron density)	54.76 Å
Total Rg	54.89 Å
Atom count	38369
Residues	4648
Excluded volume	676490 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`5xon__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	194107.4 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	38369

MSQFPYSSAPLRSVKEVQFGLLSPEEIRAISVVKIEYPEIMDESRQRPREGGLNDPKLGSIDRNFKCQTCGEGMAECPGHFGHMELAKPVFHIGFIPKIKKVCECICMNCGKLLLDETNPTMAQAIRIRDPKKRFNAVWQLCKTKMVCEADAPVDEYSEQKVVSRGGCGNTQPVVRKDGMKLWGTWKKSGFSDRDAQPERKLLTPGEILNVFKHISPEDCFRLGFNEDYARPEWMIITVLPVPPPQVRPSIAMDETTQGQDDLTHKLSDILKANINVQKLEMDGSPQHIINEVEQLLQFHVATYMDNDIAGQPQALQKSGRPVKAIRARLKGKEGRLRGNLMGKRVDFSARTVISGDPNLELDQVGVPISIAKTLSYPETVTQYNIHRLTEYVRNGPNEHPGAKYVIRDNGDRIDLRYHKRAGDIVLQYGWKVERHLMDDDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPVMGIVQDTLCGVRKMTLRDTFIEYEQVMNMLFWVPSWDGVVPQPAILKPKPLWTGKQLLSIAIPSGIHLQRTDGGNSLLSPKDNGMLIVDGKVMFGVVDKKTVGSGGGGLIHTVMREKGPKICAELFGNIQKVVNYWLLHNGFSIGIGDAIADASTMKEITHAISSAKEQVQEIIYKAQHNELELKPGMTLRESFEGEVSRTLNDARDSAGRSAEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQMVEGKRIAFGFADRSLPHFTKDDFSPESKGFVENSYLRGLTPQEFFFHAMAGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSLGDIIQFLYGEDGLDGTQVERQTIDTIPGSDKAFHKRYYVDLMDEKNSIKPDVIEYAADILGDVELQKELNSEYEQLVSDRKFLREIVFVNGDHNWPLPVNLRRIIQNAQQIFHLDRAKASDLTIPEIIHGVRDLCKKLFVLRGENELIKEAQQNATSLFQCLVRARLATRRILEEFRLNRDAFEWVLGTIEAQFQRSLVHPGEMVGVIAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEILNVAKNIKTPALTVYLDREIALDIEKAKVIQSSIEYTTLKNVTSATEIYYDPDPTSTVIEEDFDTVEAYFSIPDEKVEETIDKQSPWLLRLELDRARMLDKQLTMNQVADKISEVFSDDLFVMWSEDNADKLIIRCRVIRDPKAMDEELEAEEDQMLKRIEAHMLDLIALRGIPGISKVYMVKHKVSVPDESGEYKNEELWALETDGINLAEVMAVPGVDSSRTYSNSFVEILSVLGIEATRSSLYKEILNVIAFDGSYVNYRHMALLVDVMTSRGYLMAITRHGINRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVMLGQLAPMGTGAFDVMIDEKLLTSLPADYAPTMPLFKGKATQGSATPYDNNAQYDDEFNHDDVADVMFSPMAETGSGDDRSGGLTEYAGIQSPYQPTSPGLSATSPGFAPTSPGFAPTSPRYSPTSPGYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPTSPQYSPASPQYSPSRHSPNGESKEGE

Entity 2 Entity 2 polymer

Description description	DNA-directed RNA polymerase subunit beta
Molecular weight formula_weight	139746.1 kDa
EC 编号 ec_number	2.7.7.6
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMETSIQDLVWEEPRLILDQPAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQEARLRNLTYSSPVYLDMEKSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGKVPIMLRSKFCSLRTLDEVDLYKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFKKAAPSPISHVAEIRSALEKGSRLISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVIVFRALGVVPDGEILQHICYDENDWQMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAALGIRREKRIQYAKDILQKELLPHITQEEGFETRKTFFLGYMVNRLLLCALERKDQDDRDHFGKKRLDLAGPLLANLFRILFRKLTREIYRYMQRCIETDRDFNLNLAVKSTTITSGLKYSLATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLLSGISIGSPSEPIINFLEEWGMEPLEDYDPAQHTKSTRIFVNGVWTGIHRDPSMLVSTMRDLRRSGAISPEVSIIRDIREREFKIFTDVGRVYRPLFIVEDDESKDNKGELRITKEHIRKIQQGYDDDAMNDDSEEQEQDVYGWSSLVTSGVIEYVDGEEEETIMIAMTPEDLQTRSLEQKEIDLNDTAKRIKPEMSTSSHHTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLAKTQAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRFGISIVEEFEKPTRATTLRLKHGTYEKLDEDGLIAPGVRVSGDDIIIGKTTPIPPDTEELGQRTKYHTKRDASTPLRSTENGIVDQVLLTTNQEGLKFVKVRMRTTKVPQIGDKFASRHGQKGTIGVTYRHEDMPFSAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVGSIRGYEGDATPFTDLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKKLMAQVFFGPTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAGFLKERLMEASDAFRVHVCGICGLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAAKLLFQELMAMNIAPRLYTERSGVSMRS

Entity 3 Entity 3 polymer

Description description	RNA polymerase II third largest subunit B44, part of central core
Molecular weight formula_weight	34216.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSKEPKVNIINAQDDEVELMLSDVNLSLANSLRRTMLAEVPTLAIDLVEIKMNTSVLADEFISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSARHEGEEGTTDVYSSSLIKVSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAKKGIAKEHAKWSPCSAIAFEYDPHNKLKHTDFWFEVDAKKEWPDSKYATWEEPPKPGEVFDYKAKPNRFYMTVETTGSLKANQVFSRGIKTLQEKLANVLFELENSRPANTTAYGGATAYGGQTVYGRETSYGGNTNYGDYNAPY

Entity 4 Entity 4 polymer

Description description	RNA polymerase II subunit B32
Molecular weight formula_weight	20623.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MNVSTSTVGARRRRAKQQVDDEENATLLRLGPEFALKQYDHDGNEHDLIALSLSESRLLIREALKARSRARNGGVDIESSNGEIDDDELAKVTSGAVANGVVKKTLDYLNTFARFKDEETCTAVDQLLHNSSDCSVLHPFEIAQLSSLGCEDVDEAITLIPSLAAKKEVNLQRILDELNRLEDPYK

Entity 5 Entity 5 polymer

Description description	RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III
Molecular weight formula_weight	24962.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSKICDSMGNPQRKLMSFLANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEKNFSTGIFIYQNNITPSANKMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEKSQLLQRYKLKESQLPRIQREDPVARYLGLKRGQVVKIIRRSETSGRYASYRICL

Entity 6 Entity 6 polymer

Description description	RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III
Molecular weight formula_weight	17803.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSEDEAFNEQTENFENFEDEHFSDDNFEDRSTQPEDYAVGVTADGRQIINGDGIQEVNGTIKAHRKRSNKELAILKEERTTTPYLTKYERARILGTRALQISMNAPVLVDIEGETDPLQIAMKELSQRKIPLVIRRYLPDGSYEDWGCDELIVDN

Entity 7 Entity 7 polymer

Description description	RNA polymerase II subunit
Molecular weight formula_weight	18802.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MFFLKDLSLILTLHPSYFGPQMNQYLREKLLTDVEGTCTGQFGYIVTVLDGMNIDVGKGRIIPGSGSAEFEVKYRAVVWKPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLVYNPSNSPPAYMSNDELITKGSKVRLKVVGTRTDVNEIYAIGSIKEDFLGAI

Entity 8 Entity 8 polymer

Description description	RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III
Molecular weight formula_weight	16249.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSSALFDDIFTVQTVDNGRYNKVSRIIGISTTNSAIKLTLDINNEMFPVSQDDSLTVTLANSLSLDGEDESANFSKSWRPPKPTDKSLADDYDYVMFGTVYKFEEGDEDKIKVYVSFGGLLMCLEGGYKSLASLKQDNLYILIRR

Entity 9 Entity 9 polymer

Description description	DNA-directed RNA polymerase subunit
Molecular weight formula_weight	13612.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MASFRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDPKVYRHELITNIGETAGIVDDIGQDPTLPRSDKECPECHSRDCVFFQSQQRRKDTNMTLFYVCLNCKKTFRDESE

Entity 10 Entity 10 polymer

Description description	RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III
Molecular weight formula_weight	8554.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKFLRYNPLEKKDFDS

Entity 11 Entity 11 polymer

Description description	RNA polymerase II subunit B12.5
Molecular weight formula_weight	13832.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLANLLREELALYPDVTFVAYKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLDHKFNEEWNIKNFSLND

Entity 12 Entity 12 polymer

Description description	RNA polymerase subunit, found in RNA polymerase complexes I, II, and III
Molecular weight formula_weight	7862.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSREGFVAPSGTDLAAAASGVAPNKHYGVKYTCGACAHNFSLNKSDPVRCKECGHRVIYKARTKRMIQFDAR

Entity 13 Entity 13 polymer

Description description	RNA (30-MER)
Molecular weight formula_weight	9492.6 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P

AUCUUGAAUCUAUUUCUUUUAUCGAGAGGU

Entity 14 Entity 14 polymer

Description description	DNA (48-MER)
Molecular weight formula_weight	14659.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	T

CACTCTACCGATAAGCAGACGTACCTCTCGACCCTGTGCTAGACACGG

Entity 15 Entity 15 polymer

Description description	DNA (48-MER)
Molecular weight formula_weight	14917.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

CCGTGTCTAGCACAGGGAAATGGTTTGTGTCTGCTTATCGGTAGAGTG

Entity 16 Entity 16 polymer

Description description	General transcription elongation factor TFIIS
Molecular weight formula_weight	21694.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

GPGTNERFVSKGPRTPKNDGVKVEIYENKTRNGSISAIYTALAMDSDEQPSKIFELVKDIEKQCFKAVNFTVDDTYRNKLRSLIMNLKNKNNPTLRRSILDHEIIPSKLVTMSAQELAPDSLKKEMEEIYKKNLFDAQGATENNSVTDRFECGKCKQRKVSYFQKQTRSAAAPLTTFCKCENCGNRWKFS

Source Source

Source organism organism	Komagataella phaffii (strain GS115 / ATCC 20864)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	644223
Host organism host_organism	Escherichia coli

Entity 17 Entity 17 polymer

Description description	Transcription elongation factor SPT4
Molecular weight formula_weight	12039.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MRERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQATVNECTSSSFEGLVAVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYGVYYRPRDGSVID

Source Source

Source organism organism	Komagataella phaffii (strain GS115 / ATCC 20864)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	644223
Host organism host_organism	Escherichia coli

Entity 18 Entity 18 polymer

Description description	Protein that forms a complex with Spt4p
Molecular weight formula_weight	68284.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

GPGSASTTAPQRLLIPTVDDPGIWGVKVRLGKEKDVVRQILKKKLAREGTKNPLEIYSAFQRDSFKGHVYIEARKAEAINDALKGNVNVFSNNSKFLVGIVEYKDLLRPVKSSDVKLTRGSYVRVKNGKFKGDLAQVDEVLENGLEARLKLVPRLDYGKDLSHLSTSSSVDSTKNRRKFYTSKFRPAQRLFSEAEARVHEPTIRRDRDGFVTYGGEEYYEGFLYKTFRLQNLIVNSINPTLNELSLFQSNEESTTIDLSTIADSLKETAKNLVSFQPGDNVEIINGELNHLTGTVSSVNQSTIVSVRLHSDDDTINSETVEIPTSDLRKIFNVGDHVRVIHGKHTDDTGLIVEVNGDKVEFISNQTKRTVIVFSNYLIKSTDSTVSINESGRFELHDLVQVNSDLVGIVIRAQKDSFDVLCSDGKLLSLPPVSIYSKLNLNPNQQIAIDSNGVEVKVGDTVREFTGERRQGTILHVYRNFLFLRSREIVENQGVFVTSSNRVKTITSKSNGTGGQISGPDLSRMNPSRVIPPPSIPVANQRMTGRDPTLNKTVKIRQGGYKGKIGIVKEANGDRFRVELHNPNKTIPIPCSFLLIESTHGWVPYEDFVASDR

Source Source

Source organism organism	Komagataella phaffii (strain GS115 / ATCC 20864)
Common name common_name	Yeast
NCBI taxonomy ID ncbi_taxonomy_id	644223
Host organism host_organism	Escherichia coli

Entity 19 Entity 19 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 20 Entity 20 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 19 domains

CATH v4.4 (19 domains)

Domain ID domain_id	5xonA01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	274 — Enzyme I; Chain A, domain 2
Homologous superfamily homologous superfamily	100 — RNA polymerase Rpb1, domain 3

Domain ID domain_id	5xonA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	140 —

Domain ID domain_id	5xonB01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1110 — Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3
Homologous superfamily homologous superfamily	10 — RNA polymerase Rpb2, domain 2

Domain ID domain_id	5xonC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	5xonC02
Class class	2 — Mainly Beta
Architecture architecture	170 — Beta Complex
Topology topology	120 — RNA Polymerase Alpha Subunit; Chain A, domain 2
Homologous superfamily homologous superfamily	12 — DNA-directed RNA polymerase, insert domain

Domain ID domain_id	5xonD02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1250 — Growth Hormone; Chain: A;
Homologous superfamily homologous superfamily	40 — RNA Polymerase II, Rpb4 subunit

Domain ID domain_id	5xonE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1340 — Dna-directed Rna Polymerases I, Ii, And Iii 27 Kd Polypeptide; Chain: A; domain 1
Homologous superfamily homologous superfamily	10 — RNA polymerase, Rpb5, N-terminal domain

Domain ID domain_id	5xonE02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	20 — RPB5-like RNA polymerase subunit

Domain ID domain_id	5xonF00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	940 — Eukaryotic RPB6 RNA polymerase subunit
Homologous superfamily homologous superfamily	10 — RNA polymerase subunit, RPB6/omega

Domain ID domain_id	5xonG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1490 — Dna Ligase; domain 1
Homologous superfamily homologous superfamily	120 — RNA polymerase Rpb7-like, N-terminal domain

Domain ID domain_id	5xonG02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	5xonH00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	5xonI01
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	5xonI02
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	5xonJ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	60 — Homeodomain-like

Domain ID domain_id	5xonK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1360 — Gyrase A; domain 2
Homologous superfamily homologous superfamily	10 — RNA polymerase, RBP11-like subunit

Domain ID domain_id	5xonL00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	28 — Rubrerythrin, domain 2
Homologous superfamily homologous superfamily	30 — RNA polymerase ii, chain L

Domain ID domain_id	5xonV00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	40 — Herpes Virus-1
Homologous superfamily homologous superfamily	210 —

Domain ID domain_id	5xonW01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	940 — NusG, N-terminal domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.83 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	682749

RNA Polymerase II elongation complex bound with Spt4/5 and TFIIS

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-directed RNA polymerase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II third largest subunit B44, part of central core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II subunit B32

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC27, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase II subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC14.5, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DNA-directed RNA polymerase subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer