6ah3

Cryo-EM structure of yeast Ribonuclease P with pre-tRNA substrate

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonucleases P/MRP protein subunit POP1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP3 × 1 （P53833） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease P protein subunit RPR2 × 1 （P40571） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–875； UniProt 1–875

Ribonucleases P/MRP protein subunit POP3

OrganismNot specified

UniProt P53833

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease P protein subunit RPR2 × 1 （P40571） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP3_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–195； UniProt 1–195

RNases MRP/P 32.9 kDa subunit

OrganismNot specified

UniProt P38336

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） Ribonucleases P/MRP protein subunit POP3 × 1 （P53833） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease P protein subunit RPR2 × 1 （P40571） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP4_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–279； UniProt 1–279

Ribonuclease P/MRP protein subunit POP5

OrganismNot specified

UniProt P28005

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） Ribonucleases P/MRP protein subunit POP3 × 1 （P53833） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease P protein subunit RPR2 × 1 （P40571） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP5_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–173； UniProt 1–173

Ribonucleases P/MRP protein subunit POP6

OrganismNot specified

UniProt P53218

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） Ribonucleases P/MRP protein subunit POP3 × 1 （P53833） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease P protein subunit RPR2 × 1 （P40571） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP6_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–158； UniProt 1–158

Ribonucleases P/MRP protein subunit POP7

OrganismNot specified

UniProt P38291

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） Ribonucleases P/MRP protein subunit POP3 × 1 （P53833） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease P protein subunit RPR2 × 1 （P40571） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP7_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–140； UniProt 1–140

Ribonucleases P/MRP protein subunit POP8

OrganismNot specified

UniProt P38208

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） Ribonucleases P/MRP protein subunit POP3 × 1 （P53833） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease P protein subunit RPR2 × 1 （P40571） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP8_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–133； UniProt 1–133

Ribonuclease P/MRP protein subunit RPP1

OrganismNot specified

UniProt P38786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） Ribonucleases P/MRP protein subunit POP3 × 1 （P53833） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P protein subunit RPR2 × 1 （P40571） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP1_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–293； UniProt 1–293 Author chain J； PDBConstruct 1–293； UniProt 1–293

Ribonuclease P protein subunit RPR2

OrganismNot specified

UniProt P40571

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 2	Ribonuclease P RNA × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） Ribonucleases P/MRP protein subunit POP3 × 1 （P53833） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） pre-tRNA × 1 MAGNESIUM ION × 2 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPR2_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–144； UniProt 1–144

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ah3
Deposition date deposition_date	2018-08-16
Structure title title	Cryo-EM structure of yeast Ribonuclease P with pre-tRNA substrate
Keywords keywords	Ribonuclease P, RNA-protein complex, HYDROLASE-RNA complex; HYDROLASE/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ah3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ah3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ah3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.81 Å
Rg (electron density)	52.38 Å
Total Rg	52.45 Å
Atom count	28703
Residues	2829
Excluded volume	478610 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ah3__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Ribonuclease P RNA
Molecular weight formula_weight	118857.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	28703

GUGGAACAGUGGUAAUUCCUACGAUUAAGAAACCUGUUUACAGAAGGAUCCCCACCUAUGGGCGGGUUAUCAGAUAUUAUCAGGUGGGAAAUUCGGUGGAACACAGUGGAGCCUUGUCCUCCGGGUUAAUGUCGCUUUUGGCAUUGGCCCCUGCUCCUGAGAGAAGAAAUAUACUGGGGAACCAGUCUUUACCGACCGUUGUUAUCAGAAAUUCACGGAGUUCGGCCUAGGUCGGACUCCGAUGGGAACGGCAACGGUUGUUCCGUUUGACUUGUCGCCCGCUACGGCGUGAGCGUCAAGGUCUGUUGAGUGCAAUCGUAGGACGUCAUUAGUGGCGAACCCGAUACCGAUUACUGCUGCUGUUCCAGC

Entity 2 Entity 2 polymer

Description description	Ribonucleases P/MRP protein subunit POP1
Molecular weight formula_weight	100559.6 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSGSLSRGNGGKKVLNKNQLLKRNRIRNARSIRAEAVAASSTKTGTPSDLSESGSKLNVDQFISSRQFEVKQLQLAMHNSKAASSTRIFQALPRKLRRRTASHNVRRIPKRMRNRALREMRKSDQQDVLKGSSASSRKAHGLNAKQLYKARMSIKLLRLASKSTSMKLSMPPEVTSSNCHVRQKIKTLKRMIKESSTANPNIKLLNNRMGSYDCTGVNELAPIPKGRVKYTKRQKHFAWLPTHIWNAKRSHMMKRWGYQMVWAPTQKCFKLTHRLGGDTCSSDGALCMDSSYIGTIIVKDKSNDSEGDFLKSIIGKLTAERANLRKYREGQVLFQGLIYSFNEENGEDSTKPLGPCDVFWVQKDTAIIRLHPSIYTQVFNILLQHKEKLTVQDCRYSLASVTLKGAKALESLASCLRSTEYSKSFEQFKMVSMITDHNALPQRCTFAFEAIDPRHLAAPKKLNDSQRKTVNSDDILSLHENYPQDEINAVFNELCDPESRTQSYNNQNTLKEISARRYKLLTATPNSINKTTVPFKESDDPSIPLVIIRRLKTRDWIVVLPWFWLLPLWHLLNRIPRMYHIGLRQFQQIQYENKQLYFPDDYPFTQLGYIENSFYKKEASKTKWDRKPMGKRINFEKIKDIHNTKLPAYSGEIGDFFSSDWRFLQILRNGIDYLQRNDKTLELMDSKKTGQFNAQGVRDINCVNDVLEFCKDYEAKTKAMSLSIEENIPVALCKNRKCQFRTPDSISVNSSSFSLTFFPRCIIAVSCTLLERGHPKDNARIYQVPEKDLEHWLQLAKGVYRPNGRKDHDLKIPLPEVHDLIGFITSGTYHLNCGNGMGIGFIDHHAAIRQPTRYVLIRNVGTNTYRLGEWSKISV

Entity 3 Entity 3 polymer

Description description	Ribonucleases P/MRP protein subunit POP3
Molecular weight formula_weight	22643.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQSKENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVKLVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVKLLKTTVPIVSKKRQK

Entity 4 Entity 4 polymer

Description description	RNases MRP/P 32.9 kDa subunit
Molecular weight formula_weight	32933.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MDRTQTFIKDCLFTKCLEDPEKPFNENRFQDTLLLLPTDGGLTSRLQRQQRKSKLNLDNLQKVSQLESADKQLEKRDYQRINKNSKIALREYINNCKKNTKKCLKLAYENKITDKEDLLHYIEEKHPTIYESLPQYVDFVPMYKELWINYIKELLNITKNLKTFNGSLALLKLSMADYNGALLRVTKSKNKTLIGLQGIVIWDSQKFFIMIVKGNIIDEIKCIPKKGTVFQFEIPISDDDDSALRYSILGDRFKYRSVDRAGRKFKSRRCDDMLYYIQN

Entity 5 Entity 5 polymer

Description description	Ribonuclease P/MRP protein subunit POP5
Molecular weight formula_weight	19601.6 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MVRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQEIRRSLSLNLGDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALMLMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQSSHLSDNDFIINDFKKIGRENENENEDD

Entity 6 Entity 6 polymer

Description description	Ribonucleases P/MRP protein subunit POP6
Molecular weight formula_weight	18235.0 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MINGVYYNEISRDLDISSSTQCLRFLKETVIPSLANNGNNSTSIQYHGISKNDNIKKSVNKLDKQINMADRSLGLQQVVCIFSYGPHIQKMLSILEIFKKGYIKNNKKIYQWNKLTSFDIKREGRNELQEERLKVPILVTLVSDSEIIDLNLHSFTKQ

Entity 7 Entity 7 polymer

Description description	Ribonucleases P/MRP protein subunit POP7
Molecular weight formula_weight	15844.3 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MALKKNTHNKSTKRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYVAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVITEGQADIDMESDVEDDDKETQLKKRAVSGVELRIYV

Entity 8 Entity 8 polymer

Description description	Ribonucleases P/MRP protein subunit POP8
Molecular weight formula_weight	15530.4 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MGKKTFREWQYFKLSITSFDQDVDDAHAIDQMTWRQWLNNALKRSYGIFGEGVEYSFLHVDDKLAYIRVNHADKDTFSSSISTYISTDELVGSPLTVSILQESSSLRLLEVTDDDRLWLKKVMEEEEQDCKCI

Entity 9 Entity 9 polymer

Description description	Ribonuclease P/MRP protein subunit RPP1
Molecular weight formula_weight	32270.3 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MLVDLNVPWPQNSYADKVTSQAVNNLIKTLSTLHMLGYTHIAINFTVNHSEKFPNDVKLLNPIDIKRRFGELMDRTGLKLYSRITLIIDDPSKGQSLSKISQAFDIVAALPISEKGLTLSTTNLDIDLLTFQYGSRLPTFLKHKSICSCVNRGVKLEIVYGYALRDVQARRQFVSNVRSVIRSSRSRGIVIGSGAMSPLECRNILGVTSLIKNLGLPSDRCSKAMGDLASLVLLNGRLRNKSHKQTIVTGGGSGNGDDVVNDVQGIDDVQTIKVVKRSMDAEQLGHASKRHKP

Entity 10 Entity 10 polymer

Description description	Ribonuclease P protein subunit RPR2
Molecular weight formula_weight	16375.0 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MGKKAHGGKMKPEIDENGTLLVPPPRTIANQDHFHRLNYLYQISAYQTRARQKARTDAHTPLARNYIKSMDLISKKTKTSLLPTIKRTICKKCHRLLWTPKKLEITSDGALSVMCGCGTVKRFNIGADPNYRTYSEREGNLLNS

Entity 11 Entity 11 polymer

Description description	pre-tRNA
Molecular weight formula_weight	25830.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	T

AGAAGCGGAUUUAGCUCAGUUGGGAGAGCGCCAGACUGAAGAUCUGGAGGUCCUGUGUUCGAUCCACAGAAUUCGCAUUU

Source Source

Source organism organism	Saccharomyces cerevisiae S288c
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Saccharomyces cerevisiae

Entity 12 Entity 12 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	6ah3G01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	110 — Translation Initiation Factor IF3
Homologous superfamily homologous superfamily	20 — Alba-like domain

Domain ID domain_id	6ah3I01
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	140 — Metal-dependent hydrolases

Domain ID domain_id	6ah3J01
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	140 — Metal-dependent hydrolases

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.48 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	176896

Cryo-EM structure of yeast Ribonuclease P with pre-tRNA substrate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonucleases P/MRP protein subunit POP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNases MRP/P 32.9 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P/MRP protein subunit POP5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P/MRP protein subunit RPP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P protein subunit RPR2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ah3__assembly_1__model_1

6ah3__assembly_1__model_1 | I(q)

6ah3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment