6w6v

Structure of yeast RNase MRP holoenzyme

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonucleases P/MRP protein subunit POP1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease MRP protein subunit SNM1 × 1 （P40993） Ribonuclease MRP protein subunit RMP1 × 1 （Q12530）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–875； UniProt 1–875

RNases MRP/P 32.9 kDa subunit

OrganismNot specified

UniProt P38336

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease MRP protein subunit SNM1 × 1 （P40993） Ribonuclease MRP protein subunit RMP1 × 1 （Q12530）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP4_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–279； UniProt 1–279

Ribonuclease P/MRP protein subunit POP5

OrganismNot specified

UniProt P28005

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease MRP protein subunit SNM1 × 1 （P40993） Ribonuclease MRP protein subunit RMP1 × 1 （Q12530）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP5_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–173； UniProt 1–173

Ribonucleases P/MRP protein subunit POP6

OrganismNot specified

UniProt P53218

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease MRP protein subunit SNM1 × 1 （P40993） Ribonuclease MRP protein subunit RMP1 × 1 （Q12530）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP6_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–158； UniProt 1–158

Ribonucleases P/MRP protein subunit POP7

OrganismNot specified

UniProt P38291

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease MRP protein subunit SNM1 × 1 （P40993） Ribonuclease MRP protein subunit RMP1 × 1 （Q12530）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP7_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–140； UniProt 1–140

Ribonucleases P/MRP protein subunit POP8

OrganismNot specified

UniProt P38208

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease MRP protein subunit SNM1 × 1 （P40993） Ribonuclease MRP protein subunit RMP1 × 1 （Q12530）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POP8_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–133； UniProt 1–133

Ribonuclease P/MRP protein subunit RPP1

OrganismNot specified

UniProt P38786

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease MRP protein subunit SNM1 × 1 （P40993） Ribonuclease MRP protein subunit RMP1 × 1 （Q12530）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RPP1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–293； UniProt 1–293 Author chain J； PDBConstruct 1–293； UniProt 1–293

Ribonuclease MRP protein subunit SNM1

OrganismNot specified

UniProt P40993

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease MRP protein subunit RMP1 × 1 （Q12530）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RMRP_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain K； PDBConstruct 1–198； UniProt 1–198

Ribonuclease MRP protein subunit RMP1

OrganismNot specified

UniProt Q12530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 10 RNA 1	RNA component of RNase MRP NME1 × 1 Ribonucleases P/MRP protein subunit POP1 × 1 （P41812） RNases MRP/P 32.9 kDa subunit × 1 （P38336） Ribonuclease P/MRP protein subunit POP5 × 1 （P28005） Ribonucleases P/MRP protein subunit POP6 × 1 （P53218） Ribonucleases P/MRP protein subunit POP7 × 1 （P38291） Ribonucleases P/MRP protein subunit POP8 × 1 （P38208） Ribonuclease P/MRP protein subunit RPP1 × 2 （P38786） Ribonuclease MRP protein subunit SNM1 × 1 （P40993）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RMP1_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L； PDBConstruct 1–201； UniProt 1–201

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6w6v
Deposition date deposition_date	2020-03-17
Structure title title	Structure of yeast RNase MRP holoenzyme
Keywords keywords	ribozyme, RNP, ribonucleoprotein, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6w6v__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6w6v__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6w6v__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	48.38 Å
Rg (electron density)	48.71 Å
Total Rg	48.84 Å
Atom count	24828
Residues	2600
Excluded volume	421260 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6w6v__assembly_1__model_1`	undecameric （11）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	RNA component of RNase MRP NME1
Molecular weight formula_weight	108767.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A
Atom count atom_count	24850

AAUCCAUGACCAAAGAAUCGUCACAAAUCGAAGCUUACAAAAUGGAGUAAAAUUUUUUUUACUCAGUAAUAUGCUUUGGGUUGAAAGUCUCCCACCAAUUCGUAUGCGGAAAACGUAAUGAGAUUUAAAAAUUUUAAAUUGUUUAAAUCAACUCAUUAAGGAGGAUGCCCUUGGGUAUUCUGCUUCUUGACCUGGUACCUCUAUUGCAGGGUACUGGUGUUUUCUUCGGUACUGGAUUCCGUUUGUAUGGAAUCUAAACCAUAGUUAUGACGAUUGCUCUUUCCCGUGCUGGAUCGAGUAACCCAAUGGAGCUUACUAUUCUUGGUCCAUGGAUUCACCC

Entity 2 Entity 2 polymer

Description description	Ribonucleases P/MRP protein subunit POP1
Molecular weight formula_weight	100559.6 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSGSLSRGNGGKKVLNKNQLLKRNRIRNARSIRAEAVAASSTKTGTPSDLSESGSKLNVDQFISSRQFEVKQLQLAMHNSKAASSTRIFQALPRKLRRRTASHNVRRIPKRMRNRALREMRKSDQQDVLKGSSASSRKAHGLNAKQLYKARMSIKLLRLASKSTSMKLSMPPEVTSSNCHVRQKIKTLKRMIKESSTANPNIKLLNNRMGSYDCTGVNELAPIPKGRVKYTKRQKHFAWLPTHIWNAKRSHMMKRWGYQMVWAPTQKCFKLTHRLGGDTCSSDGALCMDSSYIGTIIVKDKSNDSEGDFLKSIIGKLTAERANLRKYREGQVLFQGLIYSFNEENGEDSTKPLGPCDVFWVQKDTAIIRLHPSIYTQVFNILLQHKEKLTVQDCRYSLASVTLKGAKALESLASCLRSTEYSKSFEQFKMVSMITDHNALPQRCTFAFEAIDPRHLAAPKKLNDSQRKTVNSDDILSLHENYPQDEINAVFNELCDPESRTQSYNNQNTLKEISARRYKLLTATPNSINKTTVPFKESDDPSIPLVIIRRLKTRDWIVVLPWFWLLPLWHLLNRIPRMYHIGLRQFQQIQYENKQLYFPDDYPFTQLGYIENSFYKKEASKTKWDRKPMGKRINFEKIKDIHNTKLPAYSGEIGDFFSSDWRFLQILRNGIDYLQRNDKTLELMDSKKTGQFNAQGVRDINCVNDVLEFCKDYEAKTKAMSLSIEENIPVALCKNRKCQFRTPDSISVNSSSFSLTFFPRCIIAVSCTLLERGHPKDNARIYQVPEKDLEHWLQLAKGVYRPNGRKDHDLKIPLPEVHDLIGFITSGTYHLNCGNGMGIGFIDHHAAIRQPTRYVLIRNVGTNTYRLGEWSKISV

Entity 3 Entity 3 polymer

Description description	RNases MRP/P 32.9 kDa subunit
Molecular weight formula_weight	32933.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MDRTQTFIKDCLFTKCLEDPEKPFNENRFQDTLLLLPTDGGLTSRLQRQQRKSKLNLDNLQKVSQLESADKQLEKRDYQRINKNSKIALREYINNCKKNTKKCLKLAYENKITDKEDLLHYIEEKHPTIYESLPQYVDFVPMYKELWINYIKELLNITKNLKTFNGSLALLKLSMADYNGALLRVTKSKNKTLIGLQGIVIWDSQKFFIMIVKGNIIDEIKCIPKKGTVFQFEIPISDDDDSALRYSILGDRFKYRSVDRAGRKFKSRRCDDMLYYIQN

Entity 4 Entity 4 polymer

Description description	Ribonuclease P/MRP protein subunit POP5
Molecular weight formula_weight	19601.6 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MVRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQEIRRSLSLNLGDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALMLMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQSSHLSDNDFIINDFKKIGRENENENEDD

Entity 5 Entity 5 polymer

Description description	Ribonucleases P/MRP protein subunit POP6
Molecular weight formula_weight	18235.0 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MINGVYYNEISRDLDISSSTQCLRFLKETVIPSLANNGNNSTSIQYHGISKNDNIKKSVNKLDKQINMADRSLGLQQVVCIFSYGPHIQKMLSILEIFKKGYIKNNKKIYQWNKLTSFDIKREGRNELQEERLKVPILVTLVSDSEIIDLNLHSFTKQ

Entity 6 Entity 6 polymer

Description description	Ribonucleases P/MRP protein subunit POP7
Molecular weight formula_weight	15844.3 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MALKKNTHNKSTKRVTKHPSLKTLTHKQIHTTIFVKSTTPYVSALKRINKFLDSVHKQGSSYVAVLGMGKAVEKTLALGCHFQDQKNKKIEVYTKTIEVLDEVITEGQADIDMESDVEDDDKETQLKKRAVSGVELRIYV

Entity 7 Entity 7 polymer

Description description	Ribonucleases P/MRP protein subunit POP8
Molecular weight formula_weight	15530.4 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MGKKTFREWQYFKLSITSFDQDVDDAHAIDQMTWRQWLNNALKRSYGIFGEGVEYSFLHVDDKLAYIRVNHADKDTFSSSISTYISTDELVGSPLTVSILQESSSLRLLEVTDDDRLWLKKVMEEEEQDCKCI

Entity 8 Entity 8 polymer

Description description	Ribonuclease P/MRP protein subunit RPP1
Molecular weight formula_weight	32270.3 kDa
EC 编号 ec_number	3.1.26.5
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MLVDLNVPWPQNSYADKVTSQAVNNLIKTLSTLHMLGYTHIAINFTVNHSEKFPNDVKLLNPIDIKRRFGELMDRTGLKLYSRITLIIDDPSKGQSLSKISQAFDIVAALPISEKGLTLSTTNLDIDLLTFQYGSRLPTFLKHKSICSCVNRGVKLEIVYGYALRDVQARRQFVSNVRSVIRSSRSRGIVIGSGAMSPLECRNILGVTSLIKNLGLPSDRCSKAMGDLASLVLLNGRLRNKSHKQTIVTGGGSGNGDDVVNDVQGIDDVQTIKVVKRSMDAEQLGHASKRHKP

Entity 9 Entity 9 polymer

Description description	Ribonuclease MRP protein subunit SNM1
Molecular weight formula_weight	22579.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNKDQAEKYQERSLRQKYNLLHVLPTLNSRALSGLYYKNFHNSVKRYQIMLPEQLKSGKFCSHCGCVYVPNFNASLQLTTNTEQGDSDELGGESMEGPKKCIQVNCLNCEKSKLFEWKSEFVVPTFGQDVSPMINSTSSGKVSYAVKKPQKSKTSTGKERSKKRKLNSLTNLLSKRNQEKKMEKKKSSSLSLESFMKS

Entity 10 Entity 10 polymer

Description description	Ribonuclease MRP protein subunit RMP1
Molecular weight formula_weight	23657.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MDEMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLFSSRRLQAKRLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLGCTLVTLLANVRALYMRLWEINETEFIRCGCLIKNLPRTKAKSVVNDVEELGEIIDEDIGNNVQENELVITSIPKPLTENCKKKKKRKKKNKSAIDGIFG

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	6w6vE01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3250 — Ribonuclease P, Pop5 subunit

Domain ID domain_id	6w6vG01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	110 — Translation Initiation Factor IF3
Homologous superfamily homologous superfamily	20 — Alba-like domain

Domain ID domain_id	6w6vI01
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	140 — Metal-dependent hydrolases

Domain ID domain_id	6w6vJ01
Class class	3 — Alpha Beta
Architecture architecture	20 — Alpha-Beta Barrel
Topology topology	20 — TIM Barrel
Homologous superfamily homologous superfamily	140 — Metal-dependent hydrolases

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	155205

Structure of yeast RNase MRP holoenzyme

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribonucleases P/MRP protein subunit POP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RNases MRP/P 32.9 kDa subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P/MRP protein subunit POP5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonucleases P/MRP protein subunit POP8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease P/MRP protein subunit RPP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease MRP protein subunit SNM1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribonuclease MRP protein subunit RMP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6w6v__assembly_1__model_1

6w6v__assembly_1__model_1 | I(q)

6w6v__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment