SAXSdb — 6akl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Suppressor of IKBKE 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 72–121 Chain B； UniProt 72–121	Not recorded	Striatin-3 × 1 （Q13033）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；35% (v/v) MPD; 0.1 M imidazole pH 7.5	Resolution 1.75 Å R-free 0.213

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6AKL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6AKK Crystal structure of the second Coiled-coil domain of SIKE1 Deposited 2018-09-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 72–121（50 aa） Chain B 72–121（50 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；1.0 M (NH4)2HPO4 (ammonium dibasic phosphate); 0.1 M acetate pH 4.5	Resolution 1.50 Å R-free 0.267
6AKM Crystal structure of SLMAP-SIKE1 complex Deposited 2018-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 5–65（61 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.1 M sodium citrate, pH 5.5; 15% (w/v) PEG 6000	Resolution 2.30 Å R-free 0.238

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SIKE1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–54； UniProt 72–121 Author chain B； PDBConstruct 5–54； UniProt 72–121

Striatin-3

OrganismNot specified

UniProt Q13033

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 165–190	Not recorded	Suppressor of IKBKE 1 × 2 （Q9BRV8）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；35% (v/v) MPD; 0.1 M imidazole pH 7.5	Resolution 1.75 Å R-free 0.213

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6AKL	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4N6J Crystal structure of human Striatin-3 coiled coil domain Deposited 2013-10-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 86–131（46 aa） Fragment：UNP residues 86-131 Chain B 86–131（46 aa） Fragment：UNP residues 86-131	Mutation：F99M, Y123M Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：F99M, Y123M Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；289 K；0.1M Bis-Tris pH 6.5, 0.2M MgCl2, 23% PEG3350, VAPOR DIFFUSION, SITTING DROP, temperature 289K	Resolution 2.00 Å R-free 0.252
6IUR A phosphatase complex STRN3-PP2Aa Deposited 2018-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 86–131（46 aa） Fragment：UNP residues 86-131 Chain D 86–131（46 aa） Fragment：UNP residues 86-131	Not recorded	TME PROPANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.1M BIS-TRIS propane pH 9.0, 8.5% PEG20000	Resolution 3.33 Å R-free 0.249
6IUR A phosphatase complex STRN3-PP2Aa Deposited 2018-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 86–131（46 aa） Fragment：UNP residues 86-131 Chain H 86–131（46 aa） Fragment：UNP residues 86-131	Not recorded	TME PROPANE × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.1M BIS-TRIS propane pH 9.0, 8.5% PEG20000	Resolution 3.33 Å R-free 0.249
7K36 Cryo-EM structure of STRIPAK complex Deposited 2020-09-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain B 1–713（713 aa） Chain D 1–713（713 aa） Chain E 1–713（713 aa） Chain F 1–713（713 aa） Chain G 1–713（713 aa）	Not recorded	MN MANGANESE (II) ION × 2 ZN ZINC ION × 2 IHP INOSITOL HEXAKISPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å

3 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	STRN3_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–26； UniProt 165–190

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6akl
Deposition date deposition_date	2018-09-02
Structure title title	Crystal structure of Striatin3 in complex with SIKE1 Coiled-coil domain
Keywords keywords	Coiled-coil domain, heterotrimer, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	20.54 Å
Radius of gyration Rg (electron density) rg_electron	20.41 Å
Forward intensity I(0) i0	4040380.00
Molecular weight molecular_weight	13939.0 kDa
Excluded volume excluded_volume	17293 Å³
Envelope volume envelope_volume	22304 Å³
Hydration-shell volume shell_volume	11016 Å³
Envelope diameter envelope_diameter	77.9 Å
Shell Rg shell_rg	23.60 Å
Envelope Rg envelope_rg	21.06 Å
Shape Rg shape_rg	20.32 Å
Total Rg total_rg	21.23 Å
Total atoms total_atoms	976
Residues n_residues	118
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	56.0 Å
Rg (real space) rg_real	19.12 Å
Rg uncertainty (real space) rg_real_error	0.13 Å
I(0) (real space) i0_real	3.8550e+06
I(0) uncertainty (real space) i0_real_error	3.9210e+04
Rg (reciprocal space) rg_reciprocal	20.87 Å
I(0) (reciprocal space) i0_reciprocal	4040000.0000
Solution quality estimate total_estimate	0.6663
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	0
Primary peak position r_peak_primary	— Å
Skewness Skewness skewness	0.445
Kurtosis Kurtosis kurtosis	-0.565
Angular range angular_range	— – 0.3850 Å⁻¹
Current regularization parameter α current_alpha	3.0430
Highest regularization parameter α highest_alpha	422800.0000
Real-space data points n_real_points	70
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.001; Oscil: 0.953; Stabil: 0.988; Sysdev: 0.000; Positv: 1.000; Valcen: 0.839; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Suppressor of IKBKE 1
Molecular weight formula_weight	6440.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	1167

STMALLSQENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Striatin-3
Molecular weight formula_weight	3153.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

PQNSQLTWKQGRQLLRQYLQEVGYTD

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	121

▶

8. Citations (1)

▶

Unit-cell length a length_a	39.282 Å
Unit-cell length b length_b	42.382 Å
Unit-cell length c length_c	91.228 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	31.048 Å
R factor r_factor	0.1893
R_work r_work	0.1866
R_free r_free	0.2133

fit	/app/data/saxs_computation/ak/6akl/6akl.fit
pddf	/app/data/pr_computation/ak/6akl/6akl.pr.out
profile	/app/data/saxs_computation/ak/6akl/6akl.dat

Crystal structure of Striatin3 in complex with SIKE1 Coiled-coil domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Suppressor of IKBKE 1

State in the Current Structure

Other States of the Same Protein in the Database

Striatin-3

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)