SAXSdb — 6akm

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Suppressor of IKBKE 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 5–65	Not recorded	Sarcolemmal membrane-associated protein × 2 （Q14BN4） GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；0.1 M sodium citrate, pH 5.5; 15% (w/v) PEG 6000	Resolution 2.30 Å R-free 0.238

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6AKM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6AKK Crystal structure of the second Coiled-coil domain of SIKE1 Deposited 2018-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 72–121（50 aa） Chain B 72–121（50 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；1.0 M (NH4)2HPO4 (ammonium dibasic phosphate); 0.1 M acetate pH 4.5	Resolution 1.50 Å R-free 0.267
6AKL Crystal structure of Striatin3 in complex with SIKE1 Coiled-coil domain Deposited 2018-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 72–121（50 aa） Chain B 72–121（50 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；35% (v/v) MPD; 0.1 M imidazole pH 7.5	Resolution 1.75 Å R-free 0.213

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SIKE1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–65； UniProt 5–65

Sarcolemmal membrane-associated protein

Homo sapiens

UniProt Q14BN4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 167–226	Not recorded	Suppressor of IKBKE 1 × 2 （Q9BRV8） GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；289 K；0.1 M sodium citrate, pH 5.5; 15% (w/v) PEG 6000	Resolution 2.30 Å R-free 0.238

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6AKM	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6AR0 Structure of human SLMAP FHA domain Deposited 2017-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–140（140 aa） Fragment：FHA domain (UNP residues 1-140)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；Bis-Tris pH 6.5, 200 mM Li2SO4, 25% PEG 3350	Resolution 1.08 Å R-free 0.179
6AR2 Structure of human SLMAP FHA domain in complex with pMST2 Deposited 2017-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–140（140 aa） Fragment：UNP residues 1-140	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；200 mM KSCN, 20% PEG 3350	Resolution 1.55 Å R-free 0.188
6AR2 Structure of human SLMAP FHA domain in complex with pMST2 Deposited 2017-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–140（140 aa） Fragment：UNP residues 1-140	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；200 mM KSCN, 20% PEG 3350	Resolution 1.55 Å R-free 0.188

2 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SLMAP_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 5–64； UniProt 167–226

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6akm
Deposition date deposition_date	2018-09-02
Structure title title	Crystal structure of SLMAP-SIKE1 complex
Keywords keywords	Coiled-coil domain, heterotetramer, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	20.15 Å
Radius of gyration Rg (electron density) rg_electron	20.37 Å
Forward intensity I(0) i0	2237060.00
Molecular weight molecular_weight	10060.0 kDa
Excluded volume excluded_volume	12428 Å³
Envelope volume envelope_volume	16549 Å³
Hydration-shell volume shell_volume	8504 Å³
Envelope diameter envelope_diameter	75.9 Å
Shell Rg shell_rg	22.58 Å
Envelope Rg envelope_rg	21.08 Å
Shape Rg shape_rg	20.31 Å
Total Rg total_rg	20.95 Å
Total atoms total_atoms	704
Residues n_residues	93
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	76.7 Å
Rg (real space) rg_real	20.60 Å
Rg uncertainty (real space) rg_real_error	0.84 Å
I(0) (real space) i0_real	2.2370e+06
I(0) uncertainty (real space) i0_real_error	3.0630e+04
Rg (reciprocal space) rg_reciprocal	20.52 Å
I(0) (reciprocal space) i0_reciprocal	2237000.0000
Solution quality estimate total_estimate	0.7053
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	15.3 Å
Skewness Skewness skewness	0.681
Kurtosis Kurtosis kurtosis	-0.195
Angular range angular_range	— – 0.3950 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	176700.0000
Real-space data points n_real_points	71
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.379; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.073; Smooth: 0.954

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Suppressor of IKBKE 1
Molecular weight formula_weight	7184.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	773

STMAIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASDMKDMS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Sarcolemmal membrane-associated protein
Molecular weight formula_weight	7421.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

STMEQLSQYLQEALHREQMLEQKLATLQRLLAITQEASDTSWQALIDEDRLLSRLEVMGNQLQA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	35

▶

8. Citations (1)

▶

Unit-cell length a length_a	66.763 Å
Unit-cell length b length_b	66.763 Å
Unit-cell length c length_c	61.353 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	42.080 Å
R factor r_factor	0.2074
R_work r_work	0.2040
R_free r_free	0.2380

fit	/app/data/saxs_computation/ak/6akm/6akm.fit
pddf	/app/data/pr_computation/ak/6akm/6akm.pr.out
profile	/app/data/saxs_computation/ak/6akm/6akm.dat

Crystal structure of SLMAP-SIKE1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Suppressor of IKBKE 1

State in the Current Structure

Other States of the Same Protein in the Database

Sarcolemmal membrane-associated protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)