SAXSdb — 6b46

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csy3

Pseudomonas aeruginosa (strain UCBPP-PA14)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	Anti-CRISPR protein AcrF1 × 2 （L7P7M1） CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） Pseudomonas aeruginosa strain SMC4485 CRISPR repeat sequence × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSY3_PSEAB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 3–344； UniProt 1–342 Author chain D； PDBConstruct 3–344； UniProt 1–342 Author chain E； PDBConstruct 3–344； UniProt 1–342 Author chain F； PDBConstruct 3–344； UniProt 1–342 Author chain G； PDBConstruct 3–344； UniProt 1–342 Author chain H； PDBConstruct 3–344； UniProt 1–342

Anti-CRISPR protein AcrF1

Pseudomonas phage JBD30

UniProt L7P7M1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	CRISPR-associated protein Csy3 × 6 （Q02MM1） CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） Pseudomonas aeruginosa strain SMC4485 CRISPR repeat sequence × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	L7P7M1_9CAUD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 3–80； UniProt 1–78 Author chain J； PDBConstruct 3–80； UniProt 1–78

CRISPR-associated endonuclease Cas6/Csy4

Pseudomonas aeruginosa (strain UCBPP-PA14)

UniProt Q02MM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 9 RNA 1	CRISPR-associated protein Csy3 × 6 （Q02MM1） Anti-CRISPR protein AcrF1 × 2 （L7P7M1） Pseudomonas aeruginosa strain SMC4485 CRISPR repeat sequence × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAS6_PSEAB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain L； PDBConstruct 3–189； UniProt 1–187

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6b46
Deposition date deposition_date	2017-09-25
Structure title title	Cryo-EM structure of Type I-F CRISPR crRNA-guided Csy surveillance complex with bound anti-CRISPR protein AcrF1
Keywords keywords	CRISPR-Cas, IMMUNE SYSTEM-HYDROLASE-RNA complex; IMMUNE SYSTEM/HYDROLASE/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6b46__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6b46__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6b46__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.63 Å
Rg (electron density)	48.78 Å
Total Rg	48.83 Å
Atom count	18344
Residues	2368
Excluded volume	316670 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6b46__assembly_1__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	CRISPR-associated protein Csy3
Molecular weight formula_weight	37781.5 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E,F,G,H
Atom count atom_count	18344

MAMSKPILSTASVLAFERKLDPSDALMSAGAWAQRDASQEWPAVTVREKSVRGTISNRLKTKDRDPAKLDASIQSPNLQTVDVANLPSDADTLKVRFTLRVLGGAGTPSACNDAAYRDKLLQTVATYVNDQGFAELARRYAHNLANARFLWRNRVGAEAVEVRINHIRQGEVARAWRFDALAIGLRDFKADAELDALAELIASGLSGSGHVLLEVVAFARIGDGQEVFPSQELILDKGDKKGQKSKTLYSVRDAAAIHSQKIGNALRTIDTWYPDEDGLGPIAVEPYGSVTSQGKAYRQPKQKLDFYTLLDNWVLRDEAPAVEQQHYVIANLIRGGVFGEAEEK

Source Source

Source organism organism	Pseudomonas aeruginosa (strain UCBPP-PA14)
NCBI taxonomy ID ncbi_taxonomy_id	208963
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Anti-CRISPR protein AcrF1
Molecular weight formula_weight	8969.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

GSMKFIKYLSTAHLNYMNIAVYENGSKIKARVENVVNGKSVGARDFDSTEQLESWFYGLPGSGLGRIENAMNEISRRENP

Source Source

Source organism organism	Pseudomonas phage JBD30
NCBI taxonomy ID ncbi_taxonomy_id	1223260
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	CRISPR-associated endonuclease Cas6/Csy4
Molecular weight formula_weight	21629.8 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MAMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF

Source Source

Source organism organism	Pseudomonas aeruginosa (strain UCBPP-PA14)
NCBI taxonomy ID ncbi_taxonomy_id	208963
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Pseudomonas aeruginosa strain SMC4485 CRISPR repeat sequence
Molecular weight formula_weight	19265.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	M

CUAAGAAAUUCACGGCGGGCUUGAUGUCCGCGUCUACCUGGUUCACUGCCGUGUAGGCAG

Source Source

Source organism organism	Pseudomonas aeruginosa
NCBI taxonomy ID ncbi_taxonomy_id	287
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d6b46l1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.53 — Ferredoxin-like domains from CRISPR-associated proteins
Family Family family	d.58.53.6 — CRISPR-associated protein Csy4-like

Domain ID domain_id	d6b46l2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.58 — Ferredoxin-like
Superfamily Superfamily superfamily	d.58.53 — Ferredoxin-like domains from CRISPR-associated proteins
Family Family family	d.58.53.6 — CRISPR-associated protein Csy4-like

CATH v4.4 (3 domains)

Domain ID domain_id	6b46I00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	67 — Viral Envelope Glycoprotein; domain 2
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	6b46J00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	67 — Viral Envelope Glycoprotein; domain 2
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	6b46L00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	2540 — CRISPR-associated endoribonuclease Cas6/Csy4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	55966

Cryo-EM structure of Type I-F CRISPR crRNA-guided Csy surveillance complex with bound anti-CRISPR protein AcrF1

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csy3

State in the Current Structure

Other States of the Same Protein in the Database

Anti-CRISPR protein AcrF1

State in the Current Structure

Other States of the Same Protein in the Database

CRISPR-associated endonuclease Cas6/Csy4

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6b46__assembly_1__model_1

6b46__assembly_1__model_1 | I(q)

6b46__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (2 domains)

CATH v4.4 (3 domains)

7. Citations (1)

Cryo-EM structure of Type I-F CRISPR crRNA-guided Csy surveillance complex with bound anti-CRISPR protein AcrF1

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csy3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anti-CRISPR protein AcrF1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated endonuclease Cas6/Csy4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6b46__assembly_1__model_1

6b46__assembly_1__model_1 | I(q)

6b46__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (2 domains)

CATH v4.4 (3 domains)

7. Citations (1)