6ne0

Structure of double-stranded target DNA engaged Csy complex from Pseudomonas aeruginosa (PA-14)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csy1

Pseudomonas aeruginosa UCBPP-PA14

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 9 DNA 2 RNA 1	CRISPR-associated protein Csy2 × 1 （Q02MM0） CRISPR-associated protein Csy3 × 6 （Q02MM1） CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） CRISPR RNA (60-MER) × 1 CRISPR target DNA (44-MER) × 1 Non-complementary R-loop DNA strand × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSY1_PSEAB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–434； UniProt 1–434

CRISPR-associated protein Csy2

Pseudomonas aeruginosa UCBPP-PA14

UniProt Q02MM0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 9 DNA 2 RNA 1	CRISPR-associated protein Csy1 × 1 （Q02ML9） CRISPR-associated protein Csy3 × 6 （Q02MM1） CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） CRISPR RNA (60-MER) × 1 CRISPR target DNA (44-MER) × 1 Non-complementary R-loop DNA strand × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSY2_PSEAB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–327； UniProt 1–327

CRISPR-associated protein Csy3

Pseudomonas aeruginosa UCBPP-PA14

UniProt Q02MM1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 9 DNA 2 RNA 1	CRISPR-associated protein Csy1 × 1 （Q02ML9） CRISPR-associated protein Csy2 × 1 （Q02MM0） CRISPR-associated endonuclease Cas6/Csy4 × 1 （Q02MM2） CRISPR RNA (60-MER) × 1 CRISPR target DNA (44-MER) × 1 Non-complementary R-loop DNA strand × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSY3_PSEAB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–342； UniProt 1–342 Author chain D； PDBConstruct 1–342； UniProt 1–342 Author chain E； PDBConstruct 1–342； UniProt 1–342 Author chain F； PDBConstruct 1–342； UniProt 1–342 Author chain G； PDBConstruct 1–342； UniProt 1–342 Author chain H； PDBConstruct 1–342； UniProt 1–342

CRISPR-associated endonuclease Cas6/Csy4

Pseudomonas aeruginosa UCBPP-PA14

UniProt Q02MM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 9 DNA 2 RNA 1	CRISPR-associated protein Csy1 × 1 （Q02ML9） CRISPR-associated protein Csy2 × 1 （Q02MM0） CRISPR-associated protein Csy3 × 6 （Q02MM1） CRISPR RNA (60-MER) × 1 CRISPR target DNA (44-MER) × 1 Non-complementary R-loop DNA strand × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAS6_PSEAB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain L； PDBConstruct 3–189； UniProt 1–187

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ne0
Deposition date deposition_date	2018-12-15
Structure title title	Structure of double-stranded target DNA engaged Csy complex from Pseudomonas aeruginosa (PA-14)
Keywords keywords	type I-F CRISPR RNA-guided surveillance complex, viral protein mimic, Csy-complex, IMMUNE SYSTEM-RNA complex; IMMUNE SYSTEM/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6ne0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6ne0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6ne0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	54.42 Å
Rg (electron density)	54.01 Å
Total Rg	54.10 Å
Atom count	24044
Residues	2979
Excluded volume	415370 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6ne0__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	CRISPR-associated protein Csy1
Molecular weight formula_weight	49194.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	24044

MTSPLPTPTWQELRQFIESFIQERLQGKLDKLQPDEDDKRQTLLATHRREAWLADAARRVGQLQLVTHTLKPIHPDARGSNLHSLPQAPGQPGLAGSHELGDRLVSDVVGNAAALDVFKFLSLQYQGKNLLNWLTEDSAEALQALSDNAEQAREWRQAFIGITTVKGAPASHSLAKQLYFPLPGSGYHLLAPLFPTSLVHHVHALLREARFGDAAKAAREARSRQESWPHGFSEYPNLAIQKFGGTKPQNISQLNNERRGENWLLPSLPPNWQRQNVNAPMRHSSVFEHDFGRTPEVSRLTRTLQRFLAKTVHNNLAIRQRRAQLVAQICDEALQYAARLRELEPGWSATPGCQLHDAEQLWLDPLRAQTDETFLQRRLRGDWPAEVGNRFANWLNRAVSSDSQILGSPEAAQWSQELSKELTMFKEILEDERD

Source Source

Source organism organism	Pseudomonas aeruginosa UCBPP-PA14
NCBI taxonomy ID ncbi_taxonomy_id	208963
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	CRISPR-associated protein Csy2
Molecular weight formula_weight	36244.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSVTDPEALLLLPRLSIQNANAISSPLTWGFPSPGAFTGFVHALQRRVGISLDIELDGVGIVCHRFEAQISQPAGKRTKVFNLTRNPLNRDGSTAAIVEEGRAHLEVSLLLGVHGDGLDDHPAQEIARQVQEQAGAMRLAGGSILPWCNERFPAPNAELLMLGGSDEQRRKNQRRLTRRLLPGFALVSREALLQQHLETLRTTLPEATTLDALLDLCRINFEPPATSSEEEASPPDAAWQVRDKPGWLVPIPAGYNALSPLYLPGEVRNARDRETPLRFVENLFGLGEWLSPHRVAALSDLLWYHHAEPDKGLYRWSTPRFVEHAIA

Source Source

Source organism organism	Pseudomonas aeruginosa UCBPP-PA14
NCBI taxonomy ID ncbi_taxonomy_id	208963
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	CRISPR-associated protein Csy3
Molecular weight formula_weight	37579.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,E,F,G,H

MSKPILSTASVLAFERKLDPSDALMSAGAWAQRDASQEWPAVTVREKSVRGTISNRLKTKDRDPAKLDASIQSPNLQTVDVANLPSDADTLKVRFTLRVLGGAGTPSACNDAAYRDKLLQTVATYVNDQGFAELARRYAHNLANARFLWRNRVGAEAVEVRINHIRQGEVARAWRFDALAIGLRDFKADAELDALAELIASGLSGSGHVLLEVVAFARIGDGQEVFPSQELILDKGDKKGQKSKTLYSVRDAAAIHSQKIGNALRTIDTWYPDEDGLGPIAVEPYGSVTSQGKAYRQPKQKLDFYTLLDNWVLRDEAPAVEQQHYVIANLIRGGVFGEAEEK

Source Source

Source organism organism	Pseudomonas aeruginosa UCBPP-PA14
NCBI taxonomy ID ncbi_taxonomy_id	208963
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	CRISPR-associated endonuclease Cas6/Csy4
Molecular weight formula_weight	21675.8 kDa
EC 编号 ec_number	3.1.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF

Source Source

Source organism organism	Pseudomonas aeruginosa UCBPP-PA14
NCBI taxonomy ID ncbi_taxonomy_id	208963
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 polymer

Description description	CRISPR RNA (60-MER)
Molecular weight formula_weight	19265.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	M

CUAAGAAAUUCACGGCGGGCUUGAUGUCCGCGUCUACCUGGUUCACUGCCGUGUAGGCAG

Entity 6 Entity 6 polymer

Description description	CRISPR target DNA (44-MER)
Molecular weight formula_weight	13584.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	N

CAGGTAGACGCGGACATCAAGCCCGCCGTGAAGGTGCAGCTTCT

Entity 7 Entity 7 polymer

Description description	Non-complementary R-loop DNA strand
Molecular weight formula_weight	10476.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	O

AGAAGCTGCACCTTCACGGCGGGCTTGATGTCCG

▶

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	291227

Structure of double-stranded target DNA engaged Csy complex from Pseudomonas aeruginosa (PA-14)

1. Protein Identity and Related Structures Protein Identity & Related Structures

CRISPR-associated protein Csy1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated protein Csy2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated protein Csy3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CRISPR-associated endonuclease Cas6/Csy4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6ne0__assembly_1__model_1

6ne0__assembly_1__model_1 | I(q)

6ne0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

7. Citations (1)