SAXSdb — 6c13

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protocadherin-15

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Homooligomer Protein × 2 其他Polymer 6 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 821–1465 Chain B； UniProt 821–1465	Not recorded	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 6	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 11.33 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6C13	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
11IY Protocadherin-15 extracellular domains 1-7 Deposited 2026-02-26	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 28–817（790 aa） Chain D 28–817（790 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.57 Å
4APX CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 AND PROTOCADHERIN-15 EC1- 2 FORM I Deposited 2012-04-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 27–259（233 aa） Fragment：EC1-2, RESIDUES 27-259	Not recorded	CA CALCIUM ION × 7 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 CL CHLORIDE ION × 1 K POTASSIUM ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1M MES, 8% PEG8000, PH6.5	Resolution 1.65 Å R-free 0.193
4AQ8 CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 AND PROTOCADHERIN-15 EC1- 2 FORM II Deposited 2012-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 27–259（233 aa） Fragment：EC1-2, RESIDUES 27-259	Not recorded	CA CALCIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 MES, 10% PEG 8000, PH 7.5	Resolution 2.63 Å R-free 0.243
4AQ8 CRYSTAL STRUCTURE OF MOUSE CADHERIN-23 EC1-2 AND PROTOCADHERIN-15 EC1- 2 FORM II Deposited 2012-04-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 27–259（233 aa） Fragment：EC1-2, RESIDUES 27-259	Not recorded	CA CALCIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；0.1 MES, 10% PEG 8000, PH 7.5	Resolution 2.63 Å R-free 0.243
4AQA CRYSTAL STRUCTURE OF DEAFNESS ASSOCIATED MUTANT MOUSE CADHERIN-23 EC1- 2D124G AND PROTOCADHERIN-15 EC1-2 FORM I Deposited 2012-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 27–259（233 aa） Fragment：EC1-2, RESIDUES 27-259	Not recorded	CA CALCIUM ION × 7 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 CL CHLORIDE ION × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 MES, 8% PEG 20000, PH 6.5	Resolution 1.96 Å R-free 0.228
4AQE CRYSTAL STRUCTURE OF DEAFNESS ASSOCIATED MUTANT MOUSE CADHERIN-23 EC1- 2S70P AND PROTOCADHERIN-15 EC1-2 FORM I Deposited 2012-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 27–259（233 aa） Fragment：EC1-2, RESIDUES 27-259	Not recorded	CA CALCIUM ION × 7 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1 M MES, 12% PEG 4000, PH 6.5	Resolution 2.27 Å R-free 0.239
4XXW Crystal structure of mouse Cadherin-23 EC1-2 and Protocadherin-15 EC1-2 splice variant Deposited 2015-01-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 27–254（228 aa）	Not recorded	CA CALCIUM ION × 7 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.2 M Ammonium Acetate 0.1 M HEPES, pH 7.5 25% (v/v) isopropanol	Resolution 2.26 Å R-free 0.233
4XXW Crystal structure of mouse Cadherin-23 EC1-2 and Protocadherin-15 EC1-2 splice variant Deposited 2015-01-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 27–254（228 aa）	Not recorded	CA CALCIUM ION × 7 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.2 M Ammonium Acetate 0.1 M HEPES, pH 7.5 25% (v/v) isopropanol	Resolution 2.26 Å R-free 0.233
5KJ4 Crystal Structure of Mouse Protocadherin-15 EC9-10 Deposited 2016-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 924–1149（226 aa） Fragment：Cadherin 9 and 10, residues 924-1149	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；0.095M HEPES (pH7.5), 0.19M CaCl2, 26.6% v/v PEG 400	Resolution 3.35 Å R-free 0.196
5KJ4 Crystal Structure of Mouse Protocadherin-15 EC9-10 Deposited 2016-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 924–1149（226 aa） Fragment：Cadherin 9 and 10, residues 924-1149	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；0.095M HEPES (pH7.5), 0.19M CaCl2, 26.6% v/v PEG 400	Resolution 3.35 Å R-free 0.196
5KJ4 Crystal Structure of Mouse Protocadherin-15 EC9-10 Deposited 2016-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 924–1149（226 aa） Fragment：Cadherin 9 and 10, residues 924-1149	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；0.095M HEPES (pH7.5), 0.19M CaCl2, 26.6% v/v PEG 400	Resolution 3.35 Å R-free 0.196
5KJ4 Crystal Structure of Mouse Protocadherin-15 EC9-10 Deposited 2016-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 924–1149（226 aa） Fragment：Cadherin 9 and 10, residues 924-1149	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277.15 K；0.095M HEPES (pH7.5), 0.19M CaCl2, 26.6% v/v PEG 400	Resolution 3.35 Å R-free 0.196
5TPK Crystal Structure of Mouse Protocadherin-15 EC7-8 V875A Deposited 2016-10-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 715–923（209 aa） Fragment：Extracellular domain residues 715-924	Mutation：V875A	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；0.2M AMMONIUM CHLORIDE, 10% PEG3350	Resolution 2.00 Å R-free 0.229
5W1D Crystal Structure of Mouse Protocadherin-15 EC4-7 Deposited 2017-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 401–818（418 aa） Fragment：residues 401-818	Not recorded	CA CALCIUM ION × 6 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.1 M Tris pH 8.5 2.0 M MgAc 23% PEG 400	Resolution 3.35 Å R-free 0.279
6BWN Crystal Structure of Mouse Protocadherin-15 EC6-7 Deposited 2017-12-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 615–818（204 aa） Fragment：Cadherin domains 6-7, residues 615-818	Not recorded	CA CALCIUM ION × 2 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；30% PEG1500	Resolution 2.94 Å R-free 0.242
6BXU Crystal Structure of Mouse Protocadherin-15 EC5-7 I582T Deposited 2017-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 507–818（312 aa） Fragment：CADHERIN DOMAINS 5-7, RESIDUES 507-818	Not recorded	CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M Na formate, 40% MPD	Resolution 3.79 Å R-free 0.283
6BXU Crystal Structure of Mouse Protocadherin-15 EC5-7 I582T Deposited 2017-12-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 507–818（312 aa） Fragment：CADHERIN DOMAINS 5-7, RESIDUES 507-818	Not recorded	CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M Na formate, 40% MPD	Resolution 3.79 Å R-free 0.283
6C10 Crystal structure of mouse PCDH15 EC11-EL Deposited 2018-01-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1151–1388（238 aa）	Not recorded	MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.2 M Lithium sulfate, 30% (w/v) PEG4000, 0.1 M Tris pH 8.5	Resolution 1.40 Å R-free 0.195
6C14 CryoEM structure of mouse PCDH15-1EC-LHFPL5 complex Deposited 2018-01-03	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1144–1465（322 aa） Chain C 1144–1465（322 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 4.50 Å
6CV7 Mouse Protocadherin-15 Extracellular Cadherin Domains 1 through 3 Deposited 2018-03-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 27–395（369 aa）	Not recorded	CA CALCIUM ION × 10 EDO 1,2-ETHANEDIOL × 10 MAN alpha-D-mannopyranose × 10 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；35% Ethylene glycol	Resolution 1.69 Å R-free 0.188
6EET Crystal structure of mouse Protocadherin-15 EC9-MAD12 Deposited 2018-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 919–1374（456 aa）	Not recorded	MAN alpha-D-mannopyranose × 3 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M HEPES sodium salt, 30% (w/v) MPD, 5% (w/v) PEG4000	Resolution 3.23 Å R-free 0.234
6N22 Crystal structure of mouse Protocadherin-15 EC1-2 BAP Deposited 2018-11-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–265（239 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；277 K；0.02 M calcium chloride, 0.1 M sodium acetate, 30% (v/v) MPD	Resolution 2.40 Å R-free 0.233
8TON Crystal Structure of Engineered Mouse Protocadherin-15 EC3-EC7 Connection Deposited 2023-08-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 262–396（135 aa） Chain A 719–820（102 aa）	Not recorded	CA CALCIUM ION × 1 NA SODIUM ION × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；15% w/v PEG 20000, 0.1 M Tris HCl pH 8.5, 0.6 uM Spermine Tetrahydrochloride	Resolution 1.94 Å R-free 0.223
8UMZ Crystal Structure of Engineered Mouse Protocadherin-15 EC4-EC7 Connection Deposited 2023-10-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 392–510（119 aa） Chain A 719–820（102 aa）	Not recorded	CA CALCIUM ION × 5 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；0.1 M Sodium cacodylate pH 6.5,40% v/v MPD,5% w/v PEG 8000	Resolution 1.63 Å R-free 0.274
8UMZ Crystal Structure of Engineered Mouse Protocadherin-15 EC4-EC7 Connection Deposited 2023-10-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 392–510（119 aa） Chain B 719–820（102 aa）	Not recorded	CA CALCIUM ION × 5 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；277 K；0.1 M Sodium cacodylate pH 6.5,40% v/v MPD,5% w/v PEG 8000	Resolution 1.63 Å R-free 0.274

18 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PCD15_MOUSE
Isoform	Q99PJ1-18
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–649； UniProt 821–1465 Author chain B； PDBConstruct 5–649； UniProt 821–1465

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6c13
Deposition date deposition_date	2018-01-03
Structure title title	CryoEM structure of mouse PCDH15-4EC-LHFPL5 complex
Keywords keywords	PCDH15, LHFPL5, protocadherin, tip link, hair cell, TMHS, hearing, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	58.93 Å
Radius of gyration Rg (electron density) rg_electron	60.83 Å
Forward intensity I(0) i0	223725000.00
Molecular weight molecular_weight	125760.0 kDa
Excluded volume excluded_volume	158460 Å³
Envelope volume envelope_volume	265060 Å³
Hydration-shell volume shell_volume	43753 Å³
Envelope diameter envelope_diameter	202.8 Å
Shell Rg shell_rg	46.99 Å
Envelope Rg envelope_rg	59.39 Å
Shape Rg shape_rg	60.85 Å
Total Rg total_rg	60.18 Å
Total atoms total_atoms	8862
Residues n_residues	1084
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	189.9 Å
Rg (real space) rg_real	60.11 Å
Rg uncertainty (real space) rg_real_error	2.32 Å
I(0) (real space) i0_real	2.2370e+08
I(0) uncertainty (real space) i0_real_error	4.9840e+06
Rg (reciprocal space) rg_reciprocal	57.88 Å
I(0) (reciprocal space) i0_reciprocal	222900000.0000
Solution quality estimate total_estimate	0.7112
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	42.2 Å
Skewness Skewness skewness	0.593
Kurtosis Kurtosis kurtosis	-0.567
Angular range angular_range	— – 0.1350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	11530000.0000
Real-space data points n_real_points	28
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.626; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.363; Smooth: 0.002

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Protocadherin-15
Molecular weight formula_weight	72989.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	8862

QYDDSPVFTNSTYTVVVEENLPAGTSFLQIEAKDVDLGANVSYRIRSPEVKHLFALHPFTGELSLLRSLDYEAFPDQEASITFLAEAFDIYGTMPPGIATVTVIVKDMNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGMPASRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIFKLVVVAFDDGEPVMSSSATVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIVAGNEEDKFGINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENDHPPVFQKKFYIGGVSEDARMFASVLRVKATDRDTGNYSAMAYRLIIPPIKEGKEGFVVETYTGLIKTAMLFHNMRRSYFKFQVIATDDYGKGLSGKADVLVSVVNQLDMQVIVSNVPPTLVEKKIEDLTEILDRYVQEQIPGAKVVVESIGARRHGDAYSLEDYSKCDLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQPYYGEGGRILEIRTPEAVTSIKKRGESLGYTEGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQSAMPAAKPAAPVPAAPAPPPPPPPPPPGAHLYEELGESAMHKYETALFESRLVPR

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	Mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 branched

Description description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	man
Copy count entity_count	6

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	11.33 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	16733

fit	/app/data/saxs_computation/c1/6c13/6c13.fit
pddf	/app/data/pr_computation/c1/6c13/6c13.pr.out
profile	/app/data/saxs_computation/c1/6c13/6c13.dat

CryoEM structure of mouse PCDH15-4EC-LHFPL5 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protocadherin-15

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 branched

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)