6emw

Structure of S.aureus ClpC in complex with MecA

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP-dependent Clp protease ATP-binding subunit

Staphylococcus aureus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4P9AXU9） Class III stress response-related ATPase, AAA+ superfamily × 6 （A0A0U1MEM2） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （W8U1E4） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） Adapter protein MecA × 6 （A0A077UK83）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4V1GG18_STAAU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–82； UniProt 713–794 Author chain G； PDBConstruct 1–82； UniProt 713–794 Author chain M； PDBConstruct 1–82； UniProt 713–794 Author chain S； PDBConstruct 1–82； UniProt 713–794 Author chain Y； PDBConstruct 1–82； UniProt 713–794 Author chain k； PDBConstruct 1–82； UniProt 713–794

ATP-dependent Clp protease ATP-binding subunit

Staphylococcus aureus

UniProt A0A4P9AXU9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4V1GG18） Class III stress response-related ATPase, AAA+ superfamily × 6 （A0A0U1MEM2） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （W8U1E4） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） Adapter protein MecA × 6 （A0A077UK83）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4P9AXU9_STAAU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–225； UniProt 488–712 Author chain H； PDBConstruct 1–225； UniProt 488–712 Author chain N； PDBConstruct 1–225； UniProt 488–712 Author chain T； PDBConstruct 1–225； UniProt 488–712 Author chain Z； PDBConstruct 1–225； UniProt 488–712 Author chain l； PDBConstruct 1–225； UniProt 488–712

Class III stress response-related ATPase, AAA+ superfamily

Staphylococcus aureus

UniProt A0A0U1MEM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4V1GG18） ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4P9AXU9） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （W8U1E4） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） Adapter protein MecA × 6 （A0A077UK83）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1MEM2_STAAU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–55； UniProt 411–465 Author chain I； PDBConstruct 1–55； UniProt 411–465 Author chain O； PDBConstruct 1–55； UniProt 411–465 Author chain U； PDBConstruct 1–55； UniProt 411–465 Author chain a； PDBConstruct 1–55； UniProt 411–465 Author chain m； PDBConstruct 1–55； UniProt 411–465

ATP-dependent Clp protease ATP-binding subunit ClpC

Staphylococcus aureus

UniProt W8U1E4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4V1GG18） ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4P9AXU9） Class III stress response-related ATPase, AAA+ superfamily × 6 （A0A0U1MEM2） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） Adapter protein MecA × 6 （A0A077UK83）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	W8U1E4_STAAU
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–145； UniProt 343–487 Author chain J； PDBConstruct 1–145； UniProt 343–487 Author chain P； PDBConstruct 1–145； UniProt 343–487 Author chain V； PDBConstruct 1–145； UniProt 343–487 Author chain b； PDBConstruct 1–145； UniProt 343–487 Author chain n； PDBConstruct 1–145； UniProt 343–487

ATP-dependent Clp protease ATP-binding subunit ClpC

Staphylococcus aureus (strain bovine RF122 / ET3-1)

UniProt Q2YSD6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4V1GG18） ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4P9AXU9） Class III stress response-related ATPase, AAA+ superfamily × 6 （A0A0U1MEM2） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （W8U1E4） Adapter protein MecA × 6 （A0A077UK83）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CLPC_STAAB
Isoform	—
PDB entities	5, 6
Chains and sequence ranges	Author chain E； PDBConstruct 1–181； UniProt 162–342 Author chain K； PDBConstruct 1–181； UniProt 162–342 Author chain Q； PDBConstruct 1–181； UniProt 162–342 Author chain W； PDBConstruct 1–181； UniProt 162–342 Author chain c； PDBConstruct 1–181； UniProt 162–342 Author chain o； PDBConstruct 1–181； UniProt 162–342 Author chain F； PDBConstruct 1–157； UniProt 5–161 Author chain L； PDBConstruct 1–157； UniProt 5–161 Author chain R； PDBConstruct 1–157； UniProt 5–161 Author chain X； PDBConstruct 1–157； UniProt 5–161 Author chain d； PDBConstruct 1–157； UniProt 5–161 Author chain p； PDBConstruct 1–157； UniProt 5–161

Adapter protein MecA

Staphylococcus aureus

UniProt A0A077UK83

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 42	ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4V1GG18） ATP-dependent Clp protease ATP-binding subunit × 6 （A0A4P9AXU9） Class III stress response-related ATPase, AAA+ superfamily × 6 （A0A0U1MEM2） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （W8U1E4） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6） ATP-dependent Clp protease ATP-binding subunit ClpC × 6 （Q2YSD6）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A077UK83_STAAU
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain e； PDBConstruct 1–90； UniProt 1–90 Author chain f； PDBConstruct 1–90； UniProt 1–90 Author chain g； PDBConstruct 1–90； UniProt 1–90 Author chain h； PDBConstruct 1–90； UniProt 1–90 Author chain i； PDBConstruct 1–90； UniProt 1–90 Author chain j； PDBConstruct 1–90； UniProt 1–90

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6emw
Deposition date deposition_date	2017-10-03
Structure title title	Structure of S.aureus ClpC in complex with MecA
Keywords keywords	Chaperone, AAA+ protein, unfoldase; CHAPERONE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6emw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6emw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6emw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.13 Å
Rg (electron density)	58.60 Å
Total Rg	58.78 Å
Atom count	15210
Residues	5070
Excluded volume	233190 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6emw__assembly_1__model_1`	42-meric （42）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	ATP-dependent Clp protease ATP-binding subunit
Molecular weight formula_weight	9325.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,G,M,S,Y,k
Atom count atom_count	15210

KLTKEELKEIVTMMVNKLTNRLSEQNINIIVTDKAKDKIAEEGYDPEYGARPLIRAIQKTIEDNLSELILDGNQIEGKKVTV

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	ATP-dependent Clp protease ATP-binding subunit
Molecular weight formula_weight	25183.6 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,H,N,T,Z,l

LTKINETESEKLLSLEDTLHERVIGQKDAVNSISKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDDDAMIRVDMSEFMEKHAVSRLVGAPPGYVGHDDGGQLTEKVRRKPYSVILFDEIEKAHPDVFNILLQVLDDGHLTDTKGRTVDFRNTIIIMTSNVGAQELQDQRFAGFGGSSDGQDYETIRKTMLKELKNSFRPEFLNRVDDIIVFH

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Class III stress response-related ATPase, AAA+ superfamily
Molecular weight formula_weight	6539.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,I,O,U,a,m

NNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKNEWKNAQN

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	ATP-dependent Clp protease ATP-binding subunit ClpC
Molecular weight formula_weight	16426.2 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,J,P,V,b,n

SVVDTVAILKGLRDRYEAHHRINISDEAIEAAVKLSNRYVSDRFLPDKAIDLIDEASSKVRLKSHTTPNNLKEIEQEIEKVKNEKDAAVHAQEFENAANLRDKQTKLEKQYEEAKNEWKNAQNGMSTSLSEEDIAEVIAGWTGIP

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	ATP-dependent Clp protease ATP-binding subunit ClpC
Molecular weight formula_weight	19699.5 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,K,Q,W,c,o

TLDSLARDLTVIAKDGTLDPVIGRDKEITRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGLAQAIVNNEVPETLKDKRVMSLDMGTVVAGTKYRGEFEERLKKVMEEIQQAGNVILFIDELHTLVGAGGAEGAIDASNILKPALARGELQCIGATTLDEYRKNIEKDAALERRFQPVQVDEP

Source Source

Source organism organism	Staphylococcus aureus (strain bovine RF122 / ET3-1)
NCBI taxonomy ID ncbi_taxonomy_id	273036
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	ATP-dependent Clp protease ATP-binding subunit ClpC
Molecular weight formula_weight	17446.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,L,R,X,d,p

RLTERAQRVLAHAQEEAIRLNHSNIGTEHLLLGLMKEPEGIAAKVLESFNITEDKVIEEVEKLIGHGQDHVGTLHYTPRAKKVIELSMDEARKLHHNFVGTEHILLGLIRENEGVAARVFANLDLNITKARAQVVKALGNPEMSNKNAQASKSNNTP

Source Source

Source organism organism	Staphylococcus aureus (strain bovine RF122 / ET3-1)
NCBI taxonomy ID ncbi_taxonomy_id	273036
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Adapter protein MecA
Molecular weight formula_weight	10758.9 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,f,g,h,i,j

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDD

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli

▶

Resolution resolution	11.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	11.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	26000

Structure of S.aureus ClpC in complex with MecA

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP-dependent Clp protease ATP-binding subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP-dependent Clp protease ATP-binding subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Class III stress response-related ATPase, AAA+ superfamily

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP-dependent Clp protease ATP-binding subunit ClpC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP-dependent Clp protease ATP-binding subunit ClpC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Adapter protein MecA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6emw__assembly_1__model_1

6emw__assembly_1__model_1 | I(q)

6emw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 polymer

Polymer Polymer

Source Source