6fkf

Chloroplast F1Fo conformation 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase delta chain, chloroplastic × 1 （P11402） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase subunit c, chloroplastic × 14 （P69447） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPA_SPIOL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–507； UniProt 1–507 Author chain C； PDBConstruct 1–507； UniProt 1–507 Author chain E； PDBConstruct 1–507； UniProt 1–507

ATP synthase subunit beta, chloroplastic

OrganismNot specified

UniProt P00825

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase delta chain, chloroplastic × 1 （P11402） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase subunit c, chloroplastic × 14 （P69447） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPB_SPIOL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–498； UniProt 1–498 Author chain D； PDBConstruct 1–498； UniProt 1–498 Author chain F； PDBConstruct 1–498； UniProt 1–498

ATP synthase gamma chain, chloroplastic

OrganismNot specified

UniProt P05435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase delta chain, chloroplastic × 1 （P11402） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase subunit c, chloroplastic × 14 （P69447） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPG_SPIOL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain g； PDBConstruct 1–364； UniProt 1–364

ATP synthase delta chain, chloroplastic

OrganismNot specified

UniProt P11402

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase gamma chain, chloroplastic × 1 （P05435） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase subunit c, chloroplastic × 14 （P69447） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPD_SPIOL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–257； UniProt 1–257

;ATP synthase subunit b', chloroplastic ;

OrganismNot specified

UniProt P31853

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase subunit c, chloroplastic × 14 （P69447） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPX_SPIOL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain p； PDBConstruct 1–222； UniProt 1–222

ATP synthase subunit b, chloroplastic

OrganismNot specified

UniProt P06453

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase delta chain, chloroplastic × 1 （P11402） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase subunit c, chloroplastic × 14 （P69447） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPF_SPIOL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain b； PDBConstruct 1–184； UniProt 1–184

ATP synthase subunit a, chloroplastic

OrganismNot specified

UniProt P06451

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase delta chain, chloroplastic × 1 （P11402） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit c, chloroplastic × 14 （P69447） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPI_SPIOL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain a； PDBConstruct 1–247； UniProt 1–247

ATP synthase subunit c, chloroplastic

OrganismNot specified

UniProt P69447

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase delta chain, chloroplastic × 1 （P11402） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPH_SPIOL
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain G； PDBConstruct 1–81； UniProt 1–81 Author chain H； PDBConstruct 1–81； UniProt 1–81 Author chain I； PDBConstruct 1–81； UniProt 1–81 Author chain J； PDBConstruct 1–81； UniProt 1–81 Author chain K； PDBConstruct 1–81； UniProt 1–81 Author chain L； PDBConstruct 1–81； UniProt 1–81 Author chain M； PDBConstruct 1–81； UniProt 1–81 Author chain N； PDBConstruct 1–81； UniProt 1–81 Author chain O； PDBConstruct 1–81； UniProt 1–81 Author chain P； PDBConstruct 1–81； UniProt 1–81 Author chain Q； PDBConstruct 1–81； UniProt 1–81 Author chain R； PDBConstruct 1–81； UniProt 1–81 Author chain S； PDBConstruct 1–81； UniProt 1–81 Author chain T； PDBConstruct 1–81； UniProt 1–81

ATP synthase epsilon chain, chloroplastic

OrganismNot specified

UniProt P00833

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase delta chain, chloroplastic × 1 （P11402） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase subunit c, chloroplastic × 14 （P69447） ADENOSINE-5'-TRIPHOSPHATE × 3 MAGNESIUM ION × 5 ADENOSINE-5'-DIPHOSPHATE × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPE_SPIOL
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain e； PDBConstruct 1–134； UniProt 1–134

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6fkf
Deposition date deposition_date	2018-01-24
Structure title title	Chloroplast F1Fo conformation 1
Keywords keywords	ATP synthase, membrane protein complex, molecular motor, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6fkf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6fkf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6fkf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	64.08 Å
Rg (electron density)	66.21 Å
Total Rg	66.06 Å
Atom count	39204
Residues	5198
Excluded volume	705340 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6fkf__assembly_1__model_1`	26-meric （26）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit alpha, chloroplastic
Molecular weight formula_weight	55505.2 kDa
EC 编号 ec_number	3.6.3.14
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	39229

MATIRADEISKIIRERIEGYNREVKVVNTGTVLQVGDGIARIHGLDEVMAGELVEFEEGTIGIALNLESNNVGVVLMGDGLMIQEGSSVKATGRIAQIPVSEAYLGRVINALAKPIDGRGEITASESRLIESPAPGIMSRRSVYEPLQTGLIAIDAMIPVGRGQRELIIGDRQTGKTAVATDTILNQQGQNVICVYVAIGQKASSVAQVVTNFQERGAMEYTIVVAETADSPATLQYLAPYTGAALAEYFMYRERHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSSLLGEGSMTALPIVETQAGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKKVAGKLKLELAQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQPQSAPLTVEEQVMTIYTGTNGYLDSLELDQVRKYLVELRTYVKTNKPEFQEIISSTKTFTEEAEALLKEAIQEQMERFLLQEQA

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit beta, chloroplastic
Molecular weight formula_weight	53797.4 kDa
EC 编号 ec_number	3.6.3.14
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F

MRINPTTSDPGVSTLEKKNLGRIAQIIGPVLDVAFPPGKMPNIYNALIVKGRDTAGQPMNVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFTQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKETLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDEATAKAMNLEMESKLKK

Entity 3 Entity 3 polymer

Description description	ATP synthase gamma chain, chloroplastic
Molecular weight formula_weight	40119.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MACSLSFSSSVSTFHLPTTTQSTQAPPNNATTLPTTNPIQCANLRELRDRIGSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNMNEQLQTEDVDVPLTKIRTVKKVALMVVTGDRGLCGGFNNMLLKKAESRIAELKKLGVDYTIISIGKKGNTYFIRRPEIPVDRYFDGTNLPTAKEAQAIADDVFSLFVSEEVDKVEMLYTKFVSLVKSDPVIHTLLPLSPKGEICDINGKCVDAAEDELFRLTTKEGKLTVERDMIKTETPAFSPILEFEQDPAQILDALLPLYLNSQILRALQESLASELAARMTAMSNATDNANELKKTLSINYNRARQAKITGEILEIVAGANACV

Entity 4 Entity 4 polymer

Description description	ATP synthase delta chain, chloroplastic
Molecular weight formula_weight	27708.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAALQNPVALQSRTTTAVAALSTSSTTSTPKPFSLSFSSSTATFNPLRLKILTASKLTAKPRGGALGTRMVDSTASRYASALADVADVTGTLEATNSDVEKLIRIFSEEPVYYFFANPVISIDNKRSVLDEIITTSGLQPHTANFINILIDSERINLVKEILNEFEDVFNKITGTEVAVVTSVVKLENDHLAQIAKGVQKITGAKNVRIKTVIDPSLVAGFTIRYGNEGSKLVDMSVKKQLEEIAAQLEMDDVTLAV

Entity 5 Entity 5 polymer

Description description	;ATP synthase subunit b', chloroplastic ;
Molecular weight formula_weight	24487.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MANMLVASSSKTLPTTTTTTITPKPKFPLLKTPLLKLSPPQLPPLKHLNLSVLKSAAITATPLTLSFLLPYPSLAEEIEKASLFDFNLTLPIIMAEFLFLMFALDKIYYTPLGDFMDKRDASIKEQLSGVKDTSSEVKQLEEQANAVMRAARAEISAALNKMKKETQLEVEAKLAEGRKKIEVELQEALGSLEQQKEDTIKSLDSQISALSDDIVKKVLPVS

Entity 6 Entity 6 polymer

Description description	ATP synthase subunit b, chloroplastic
Molecular weight formula_weight	21013.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MKNVTDSFVFLGHWPSAGSFGFNTDILATNLINLSVVLGVLIFFGKGVLSDLLDNRKQRILNTIRNSEELRGKAIEQLEKARARLKKVEMDADQFRVNGYSEIEREKMNLINSTYKTLEQFENYKNETIQFEQQKAINQVRQRVFQQALQGALGTLNSCLNNELHLRTINANIGMFGAMNEITD

Entity 7 Entity 7 polymer

Description description	ATP synthase subunit a, chloroplastic
Molecular weight formula_weight	27102.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MNVLSYSINPLKGLYAISGVEVGQHFYWQIGGFQIHGQVLITSWVVIAILLGSAAIAVRSPQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYRPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESLEGHH

Entity 8 Entity 8 polymer

Description description	ATP synthase subunit c, chloroplastic
Molecular weight formula_weight	7977.4 kDa
Source method src_method	nat
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,N,O,P,Q,R,M,T,G,H,L,K,J,I

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFV

Entity 9 Entity 9 polymer

Description description	ATP synthase epsilon chain, chloroplastic
Molecular weight formula_weight	14715.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MTLNLCVLTPNRSIWNSEVKEIILSTNSGQIGVLPNHAPTATAVDIGILRIRLNDQWLTLALMGGFARIGNNEITILVNDAERGSDIDPQEAQQTLEIAEANLRKAEGKRQKIEANLALRRARTRVEASNTISS

Entity 10 Entity 10 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 11 Entity 11 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 12 Entity 12 non-polymer

Description description	ADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	427.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 13 Entity 13 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	25

▼

6. Fold Classification (SCOP + CATH) 51 domains

SCOP 2.08 (18 domains)

Domain ID domain_id	d6fkfa1
Class class	b — All beta proteins
Fold Fold fold	b.49 — Domain of alpha and beta subunits of F1 ATP synthase-like
Superfamily Superfamily superfamily	b.49.1 — N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	b.49.1.0 — automated matches

Domain ID domain_id	d6fkfa2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d6fkfa3
Class class	a — All alpha proteins
Fold Fold fold	a.69 — Left-handed superhelix
Superfamily Superfamily superfamily	a.69.1 — C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	a.69.1.0 — automated matches

Domain ID domain_id	d6fkfb1
Class class	b — All beta proteins
Fold Fold fold	b.49 — Domain of alpha and beta subunits of F1 ATP synthase-like
Superfamily Superfamily superfamily	b.49.1 — N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	b.49.1.0 — automated matches

Domain ID domain_id	d6fkfb2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.11 — RecA protein-like (ATPase-domain)

Domain ID domain_id	d6fkfb3
Class class	a — All alpha proteins
Fold Fold fold	a.69 — Left-handed superhelix
Superfamily Superfamily superfamily	a.69.1 — C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	a.69.1.0 — automated matches

Domain ID domain_id	d6fkfc1
Class class	b — All beta proteins
Fold Fold fold	b.49 — Domain of alpha and beta subunits of F1 ATP synthase-like
Superfamily Superfamily superfamily	b.49.1 — N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	b.49.1.0 — automated matches

Domain ID domain_id	d6fkfc2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d6fkfc3
Class class	a — All alpha proteins
Fold Fold fold	a.69 — Left-handed superhelix
Superfamily Superfamily superfamily	a.69.1 — C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	a.69.1.0 — automated matches

Domain ID domain_id	d6fkfd1
Class class	b — All beta proteins
Fold Fold fold	b.49 — Domain of alpha and beta subunits of F1 ATP synthase-like
Superfamily Superfamily superfamily	b.49.1 — N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	b.49.1.0 — automated matches

Domain ID domain_id	d6fkfd2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.11 — RecA protein-like (ATPase-domain)

Domain ID domain_id	d6fkfd3
Class class	a — All alpha proteins
Fold Fold fold	a.69 — Left-handed superhelix
Superfamily Superfamily superfamily	a.69.1 — C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	a.69.1.0 — automated matches

Domain ID domain_id	d6fkfe1
Class class	b — All beta proteins
Fold Fold fold	b.49 — Domain of alpha and beta subunits of F1 ATP synthase-like
Superfamily Superfamily superfamily	b.49.1 — N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	b.49.1.0 — automated matches

Domain ID domain_id	d6fkfe2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d6fkfe3
Class class	a — All alpha proteins
Fold Fold fold	a.69 — Left-handed superhelix
Superfamily Superfamily superfamily	a.69.1 — C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	a.69.1.0 — automated matches

Domain ID domain_id	d6fkff1
Class class	b — All beta proteins
Fold Fold fold	b.49 — Domain of alpha and beta subunits of F1 ATP synthase-like
Superfamily Superfamily superfamily	b.49.1 — N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	b.49.1.0 — automated matches

Domain ID domain_id	d6fkff2
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.11 — RecA protein-like (ATPase-domain)

Domain ID domain_id	d6fkff3
Class class	a — All alpha proteins
Fold Fold fold	a.69 — Left-handed superhelix
Superfamily Superfamily superfamily	a.69.1 — C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases
Family Family family	a.69.1.0 — automated matches

CATH v4.4 (33 domains)

Domain ID domain_id	6fkfA01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6fkfA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6fkfA03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6fkfB01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6fkfB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6fkfB03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6fkfC01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6fkfC02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6fkfC03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6fkfD01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6fkfD02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6fkfD03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6fkfE01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6fkfE02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6fkfE03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	150 — Lysin
Homologous superfamily homologous superfamily	20 — ATP synthase alpha/beta chain, C-terminal domain

Domain ID domain_id	6fkfF01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	170 —

Domain ID domain_id	6fkfF02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	6fkfF03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1140 — Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3
Homologous superfamily homologous superfamily	10 — Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3

Domain ID domain_id	6fkfG01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfH01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfI01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfJ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfK01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfL01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfM01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfN01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfO01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfP01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfQ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfR01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfS01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfT01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	20 — F1FO ATP Synthase
Homologous superfamily homologous superfamily	10 — F1F0 ATP synthase subunit C

Domain ID domain_id	6fkfe01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	15 — ATP Synthase; domain 1
Homologous superfamily homologous superfamily	10 — F0F1 ATP synthase delta/epsilon subunit, N-terminal

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.150 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.15 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	167171

Chloroplast F1Fo conformation 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit beta, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase gamma chain, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase delta chain, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;ATP synthase subunit b', chloroplastic ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit b, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit a, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit c, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase epsilon chain, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6fkf__assembly_1__model_1

6fkf__assembly_1__model_1 | I(q)

6fkf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment