6vm1

Chloroplast ATP synthase (C3, CF1FO)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase subunit b, chloroplastic × 1 （P06453） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase subunit c, chloroplastic × 14 （P69447）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPA_SPIOL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–507； UniProt 1–507 Author chain B； PDBConstruct 1–507； UniProt 1–507 Author chain C； PDBConstruct 1–507； UniProt 1–507

ATP synthase subunit beta, chloroplastic

OrganismNot specified

UniProt P00825

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit b, chloroplastic × 1 （P06453） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase subunit c, chloroplastic × 14 （P69447）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPB_SPIOL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–498； UniProt 1–498 Author chain E； PDBConstruct 1–498； UniProt 1–498 Author chain F； PDBConstruct 1–498； UniProt 1–498

ATP synthase subunit b, chloroplastic

OrganismNot specified

UniProt P06453

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase subunit c, chloroplastic × 14 （P69447）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPF_SPIOL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–184； UniProt 1–184

;ATP synthase subunit b', chloroplastic ;

OrganismNot specified

UniProt P31853

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase subunit b, chloroplastic × 1 （P06453） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase subunit c, chloroplastic × 14 （P69447）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPX_SPIOL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain J； PDBConstruct 1–222； UniProt 1–222

ATP synthase subunit a, chloroplastic

OrganismNot specified

UniProt P06451

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase subunit b, chloroplastic × 1 （P06453） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase subunit c, chloroplastic × 14 （P69447）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPI_SPIOL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain a； PDBConstruct 1–247； UniProt 1–247

ATP synthase delta chain, chloroplastic

OrganismNot specified

UniProt P11402

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase subunit b, chloroplastic × 1 （P06453） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase subunit c, chloroplastic × 14 （P69447）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPD_SPIOL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain d； PDBConstruct 1–257； UniProt 1–257

ATP synthase epsilon chain, chloroplastic

OrganismNot specified

UniProt P00833

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase subunit b, chloroplastic × 1 （P06453） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase gamma chain, chloroplastic × 1 （P05435） ATP synthase subunit c, chloroplastic × 14 （P69447）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPE_SPIOL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain e； PDBConstruct 1–134； UniProt 1–134

ATP synthase gamma chain, chloroplastic

OrganismNot specified

UniProt P05435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase subunit b, chloroplastic × 1 （P06453） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ATP synthase subunit c, chloroplastic × 14 （P69447）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPG_SPIOL
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain g； PDBConstruct 1–364； UniProt 1–364

ATP synthase subunit c, chloroplastic

OrganismNot specified

UniProt P69447

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	ATP synthase subunit alpha, chloroplastic × 3 （P06450） ATP synthase subunit beta, chloroplastic × 3 （P00825） ATP synthase subunit b, chloroplastic × 1 （P06453） ;ATP synthase subunit b', chloroplastic ; × 1 （P31853） ATP synthase subunit a, chloroplastic × 1 （P06451） ATP synthase delta chain, chloroplastic × 1 （P11402） ATP synthase epsilon chain, chloroplastic × 1 （P00833） ATP synthase gamma chain, chloroplastic × 1 （P05435）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ATPH_SPIOL
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain M； PDBConstruct 1–81； UniProt 1–81 Author chain N； PDBConstruct 1–81； UniProt 1–81 Author chain O； PDBConstruct 1–81； UniProt 1–81 Author chain P； PDBConstruct 1–81； UniProt 1–81 Author chain Q； PDBConstruct 1–81； UniProt 1–81 Author chain R； PDBConstruct 1–81； UniProt 1–81 Author chain S； PDBConstruct 1–81； UniProt 1–81 Author chain T； PDBConstruct 1–81； UniProt 1–81 Author chain U； PDBConstruct 1–81； UniProt 1–81 Author chain V； PDBConstruct 1–81； UniProt 1–81 Author chain W； PDBConstruct 1–81； UniProt 1–81 Author chain X； PDBConstruct 1–81； UniProt 1–81 Author chain Y； PDBConstruct 1–81； UniProt 1–81 Author chain Z； PDBConstruct 1–81； UniProt 1–81

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6vm1
Deposition date deposition_date	2020-01-27
Structure title title	Chloroplast ATP synthase (C3, CF1FO)
Keywords keywords	CF1FO, ATP synthase, PHOTOSYNTHESIS, PHOTOSYNTHESIS-TRANSLOCASE complex; PHOTOSYNTHESIS/TRANSLOCASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6vm1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6vm1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6vm1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	67.33 Å
Rg (electron density)	67.83 Å
Total Rg	67.76 Å
Atom count	25331
Residues	5161
Excluded volume	407600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6vm1__assembly_1__model_1`	26-meric （26）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	ATP synthase subunit alpha, chloroplastic
Molecular weight formula_weight	55505.2 kDa
EC 编号 ec_number	7.1.2.2
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	25331

MATIRADEISKIIRERIEGYNREVKVVNTGTVLQVGDGIARIHGLDEVMAGELVEFEEGTIGIALNLESNNVGVVLMGDGLMIQEGSSVKATGRIAQIPVSEAYLGRVINALAKPIDGRGEITASESRLIESPAPGIMSRRSVYEPLQTGLIAIDAMIPVGRGQRELIIGDRQTGKTAVATDTILNQQGQNVICVYVAIGQKASSVAQVVTNFQERGAMEYTIVVAETADSPATLQYLAPYTGAALAEYFMYRERHTLIIYDDLSKQAQAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLSSLLGEGSMTALPIVETQAGDVSAYIPTNVISITDGQIFLSADLFNAGIRPAINVGISVSRVGSAAQIKAMKKVAGKLKLELAQFAELEAFAQFASDLDKATQNQLARGQRLRELLKQPQSAPLTVEEQVMTIYTGTNGYLDSLELDQVRKYLVELRTYVKTNKPEFQEIISSTKTFTEEAEALLKEAIQEQMERFLLQEQA

Entity 2 Entity 2 polymer

Description description	ATP synthase subunit beta, chloroplastic
Molecular weight formula_weight	53797.4 kDa
EC 编号 ec_number	7.1.2.2
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

MRINPTTSDPGVSTLEKKNLGRIAQIIGPVLDVAFPPGKMPNIYNALIVKGRDTAGQPMNVTCEVQQLLGNNRVRAVAMSATDGLTRGMEVIDTGAPLSVPVGGATLGRIFNVLGEPVDNLGPVDTRTTSPIHRSAPAFTQLDTKLSIFETGIKVVDLLAPYRRGGKIGLFGGAGVGKTVLIMELINNIAKAHGGVSVFGGVGERTREGNDLYMEMKESGVINEQNIAESKVALVYGQMNEPPGARMRVGLTALTMAEYFRDVNEQDVLLFIDNIFRFVQAGSEVSALLGRMPSAVGYQPTLSTEMGSLQERITSTKEGSITSIQAVYVPADDLTDPAPATTFAHLDATTVLSRGLAAKGIYPAVDPLDSTSTMLQPRIVGEEHYEIAQRVKETLQRYKELQDIIAILGLDELSEEDRLTVARARKIERFLSQPFFVAEVFTGSPGKYVGLAETIRGFQLILSGELDSLPEQAFYLVGNIDEATAKAMNLEMESKLKK

Entity 3 Entity 3 polymer

Description description	ATP synthase subunit b, chloroplastic
Molecular weight formula_weight	21013.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MKNVTDSFVFLGHWPSAGSFGFNTDILATNLINLSVVLGVLIFFGKGVLSDLLDNRKQRILNTIRNSEELRGKAIEQLEKARARLKKVEMDADQFRVNGYSEIEREKMNLINSTYKTLEQFENYKNETIQFEQQKAINQVRQRVFQQALQGALGTLNSCLNNELHLRTINANIGMFGAMNEITD

Entity 4 Entity 4 polymer

Description description	;ATP synthase subunit b', chloroplastic ;
Molecular weight formula_weight	24487.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MANMLVASSSKTLPTTTTTTITPKPKFPLLKTPLLKLSPPQLPPLKHLNLSVLKSAAITATPLTLSFLLPYPSLAEEIEKASLFDFNLTLPIIMAEFLFLMFALDKIYYTPLGDFMDKRDASIKEQLSGVKDTSSEVKQLEEQANAVMRAARAEISAALNKMKKETQLEVEAKLAEGRKKIEVELQEALGSLEQQKEDTIKSLDSQISALSDDIVKKVLPVS

Entity 5 Entity 5 polymer

Description description	ATP synthase subunit a, chloroplastic
Molecular weight formula_weight	27102.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MNVLSYSINPLKGLYAISGVEVGQHFYWQIGGFQIHGQVLITSWVVIAILLGSAAIAVRSPQTIPTGGQNFFEYVLEFIRDVSKTQIGEEYRPWVPFIGTMFLFIFVSNWSGALLPWKIIQLPHGELAAPTNDINTTVALALLTSVAYFYAGLTKKGLGYFGKYIQPTPILLPINILEDFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIGESLEGHH

Entity 6 Entity 6 polymer

Description description	ATP synthase delta chain, chloroplastic
Molecular weight formula_weight	27708.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MAALQNPVALQSRTTTAVAALSTSSTTSTPKPFSLSFSSSTATFNPLRLKILTASKLTAKPRGGALGTRMVDSTASRYASALADVADVTGTLEATNSDVEKLIRIFSEEPVYYFFANPVISIDNKRSVLDEIITTSGLQPHTANFINILIDSERINLVKEILNEFEDVFNKITGTEVAVVTSVVKLENDHLAQIAKGVQKITGAKNVRIKTVIDPSLVAGFTIRYGNEGSKLVDMSVKKQLEEIAAQLEMDDVTLAV

Entity 7 Entity 7 polymer

Description description	ATP synthase epsilon chain, chloroplastic
Molecular weight formula_weight	14715.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MTLNLCVLTPNRSIWNSEVKEIILSTNSGQIGVLPNHAPTATAVDIGILRIRLNDQWLTLALMGGFARIGNNEITILVNDAERGSDIDPQEAQQTLEIAEANLRKAEGKRQKIEANLALRRARTRVEASNTISS

Entity 8 Entity 8 polymer

Description description	ATP synthase gamma chain, chloroplastic
Molecular weight formula_weight	40119.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g

MACSLSFSSSVSTFHLPTTTQSTQAPPNNATTLPTTNPIQCANLRELRDRIGSVKNTQKITEAMKLVAAAKVRRAQEAVVNGRPFSETLVEVLYNMNEQLQTEDVDVPLTKIRTVKKVALMVVTGDRGLCGGFNNMLLKKAESRIAELKKLGVDYTIISIGKKGNTYFIRRPEIPVDRYFDGTNLPTAKEAQAIADDVFSLFVSEEVDKVEMLYTKFVSLVKSDPVIHTLLPLSPKGEICDINGKCVDAAEDELFRLTTKEGKLTVERDMIKTETPAFSPILEFEQDPAQILDALLPLYLNSQILRALQESLASELAARMTAMSNATDNANELKKTLSINYNRARQAKITGEILEIVAGANACV

Entity 9 Entity 9 polymer

Description description	ATP synthase subunit c, chloroplastic
Molecular weight formula_weight	7977.4 kDa
Source method src_method	nat
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,Q,P,O,N,M,Z,Y,X,W,V,U,T,S

MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFV

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	7.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	13947

Chloroplast ATP synthase (C3, CF1FO)

1. Protein Identity and Related Structures Protein Identity & Related Structures

ATP synthase subunit alpha, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit beta, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit b, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;ATP synthase subunit b', chloroplastic ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit a, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase delta chain, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase epsilon chain, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase gamma chain, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ATP synthase subunit c, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6vm1__assembly_1__model_1

6vm1__assembly_1__model_1 | I(q)

6vm1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment