SAXSdb — 6hy0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major inner protein P1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 780	Packaging Enzyme P4 × 60 Major Outer Capsid Protein P8 × 600	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	P1_BPPH6
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–769； UniProt 1–769 Author chain B； PDBConstruct 1–769； UniProt 1–769 Author chain C； PDBConstruct 1–332； UniProt 1–332 Author chain D； PDBConstruct 1–149； UniProt 1–149 Author chain E； PDBConstruct 1–149； UniProt 1–149 Author chain F； PDBConstruct 1–149； UniProt 1–149 Author chain G； PDBConstruct 1–149； UniProt 1–149 Author chain H； PDBConstruct 1–149； UniProt 1–149 Author chain I； PDBConstruct 1–149； UniProt 1–149 Author chain J； PDBConstruct 1–149； UniProt 1–149 Author chain K； PDBConstruct 1–149； UniProt 1–149 Author chain L； PDBConstruct 1–149； UniProt 1–149 Author chain M； PDBConstruct 1–149； UniProt 1–149

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6hy0
Deposition date deposition_date	2018-10-18
Structure title title	Atomic models of P1, P4 C-terminal fragment and P8 fitted in the bacteriophage phi6 nucleocapsid reconstructed with icosahedral symmetry
Keywords keywords	virus, dsRNA, capsid; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6hy0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6hy0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6hy0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	251.30 Å
Total Rg	251.50 Å
Atom count	1403160
Residues	183060
Excluded volume	25093000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6hy0__assembly_1__model_1`	780-meric （780）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Major inner protein P1
Molecular weight formula_weight	85080.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	23386

MFNLKVKDLNGSARGLTQAFAIGELKNQLSVGALQLPLQFTRTFSASMTSELLWEVGKGNIDPVMYARLFFQYAQAGGALSVDELVNQFTEYHQSTACNPEIWRKLTAYITGSSNRAIKADAVGKVPPTAILEQLRTLAPSEHELFHHITTDFVCHVLSPLGFILPDAAYVYRVGRTATYPNFYALVDCVRASDLRRMLTALSSVDSKMLQATFKAKGALAPALISQHLANAATTAFERSRGNFDANAVVSSVLTILGRLWSPSTPKELDPSARLRNTNGIDQLRSNLALFIAYQDMVKQRGRAEVIFSDEELSSTIIPWFIEAMSEVSPFKLRPINETTSYIGQTSAIDHMGQPSHVVVYEDWQFAKEITAFTPVKLANNSNQRFLDVEPGISDRMSATLAPIGNTFAVSAFVKNRTAVYEAVSQRGTVNSNGAEMTLGFPSVVERDYALDRDPMVAIAALRTGIVDESLEARASNDLKRSMFNYYAAVMHYAVAHNPEVVVSEHQGVAAEQGSLYLVWNVRTELRIPVGYNAIEGGSIRTPEPLEAIAYNKPIQPSEVLQAKVLDLANHTTSIHIWPWHEASTEFAYEDAYSVTIRNKRYTAEVKEFELLGLGQRRERVRILKPTVAHAIIQMWYSWFVEDDRTLAAARRTSRDDAEKLAIDGRRMQNAVTLLRKIEMIGTTGIGASAVHLAQSRIVDQMAGRGLIDDSSDLHVGINRHRIRIWAGLAVLQMMGLLSRSEAEALTKVLGDSNALGMVVATTDIDPSL

Entity 2 Entity 2 polymer

Description description	Packaging Enzyme P4
Molecular weight formula_weight	35198.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MPIVVTQAHIDRVGIAADLLDASPVSLQVLGRPTAINTVVIKTYIAAVMELASKQGGSLAGVDIRPSVLLKDTAIFTKPKAKSADVESDVDVLDTGIYSVPGLARKPVTHRWPSEGIYSGVTALMGATGSGKSITLNEKLRPDVLIRWGEVAEAYDELDTAVHISTLDEMLIVCIGLGALGFNVAVDSVRPLLFRLKGAASAGGIVAVFYSLLTDISNLFTQYDCSVVMVVNPMVDAEKIEYVFGQVMASTVGAILCADGNVSRTMFRTNKGRIFNGAAPLAADTHMPSMDRPTSMKALDHTSIASVAPLERGSVDTDDRNSAPRRGANFSL

Entity 3 Entity 3 polymer

Description description	Major Outer Capsid Protein P8
Molecular weight formula_weight	16018.4 kDa
Source method src_method	nat
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F,G,H,I,J,K,L,M

MLLPVVARAAVPAIESAIAATPGLVSRIAAAIGSKVSPSAILAAVKSNPVVAGLTLAQIGSTGYDAYQQLLENHPEVAEMLKDLSFKADEIQPDFIGNLGQYREELELVEDAARFVGGMSNLIRLRQALELDIKYYGLKMQLNDMGYRS

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	55265

Atomic models of P1, P4 C-terminal fragment and P8 fitted in the bacteriophage phi6 nucleocapsid reconstructed with icosahedral symmetry

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major inner protein P1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6hy0__assembly_1__model_1

6hy0__assembly_1__model_1 | I(q)

6hy0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Atomic models of P1, P4 C-terminal fragment and P8 fitted in the bacteriophage phi6 nucleocapsid reconstructed with icosahedral symmetry

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major inner protein P1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6hy0__assembly_1__model_1

6hy0__assembly_1__model_1 | I(q)

6hy0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)