SAXSdb — 6igk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Endothelin receptor type B,Endolysin,Endothelin receptor type B

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 2–161	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	Endothelin-3 × 1 （P14138） OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 12 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 500DME, Ammonium citrate tribasic	Resolution 2.00 Å R-free 0.227

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6IGK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4UIS The cryoEM structure of human gamma-Secretase complex Deposited 2015-04-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain G 1–162（162 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 0.1% DIGITONIN, 25 MM HEPES, PH 7.4, AND 150 MM NACL.；pH 7.4；0.1% DIGITONIN, 25 MM HEPES, PH 7.4, AND 150 MM NACL. cryo-EM vitrification conditions Cryogen ETHANE；VITRIFICATION 1 -- CRYOGEN- ETHANE, HUMIDITY- 100, TEMPERATURE- 277, INSTRUMENT- FEI VITROBOT MARK IV, METHOD- BLOT FOR 3 SECONDS BEFORE PLUNGING,	Resolution 4.40 Å
6A73 Complex structure of CSN2 with IP6 Deposited 2018-07-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–164（163 aa）	Mutation：C54T, C97A	IHP INOSITOL HEXAKISPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M ammonium sulfate ,100mM Bis-Tris pH 5.5, 25%PEG 3350.	Resolution 2.45 Å R-free 0.288
6A73 Complex structure of CSN2 with IP6 Deposited 2018-07-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–164（163 aa）	Mutation：C54T, C97A	IHP INOSITOL HEXAKISPHOSPHATE × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.2 M ammonium sulfate ,100mM Bis-Tris pH 5.5, 25%PEG 3350.	Resolution 2.45 Å R-free 0.288
6A9E Crystal structure of the N-terminal domain of Atg2 Deposited 2018-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–161（161 aa）	Mutation：D20N, C54T, C97A Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG400, ammonium sulfate, Bis-Tris	Resolution 3.21 Å R-free 0.266
6A9E Crystal structure of the N-terminal domain of Atg2 Deposited 2018-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–161（161 aa）	Mutation：D20N, C54T, C97A Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG400, ammonium sulfate, Bis-Tris	Resolution 3.21 Å R-free 0.266
6A9J Crystal structure of the PE-bound N-terminal domain of Atg2 Deposited 2018-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–161（161 aa）	Mutation：D20N, C54T, C97A	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG400, ammonium sulfate, Bis-Tris	Resolution 2.70 Å R-free 0.268
6A9J Crystal structure of the PE-bound N-terminal domain of Atg2 Deposited 2018-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–161（161 aa）	Mutation：D20N, C54T, C97A	PEE 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG400, ammonium sulfate, Bis-Tris	Resolution 2.70 Å R-free 0.268
6E67 Structure of beta2 adrenergic receptor fused to a Gs peptide Deposited 2018-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–161（160 aa） Fragment：beta-2 (UNP residues 1-232), lysozyme (UNP residues 2-161), GS (UNP residues 1024-1036)	Mutation：;M96T, M98T, N187E, C22A, C1054T, C1097A,M96T, M98T, N187E, C1054T, C1097A,M96T, M98T, N187E, C1054T, C1097A,M96T, M98T, N187E, C1054T, C1097A ;	P0G 8-[(1R)-2-{[1,1-dimethyl-2-(2-methylphenyl)ethyl]amino}-1-hydroxyethyl]-5-hydroxy-2H-1,4-benzoxazin-3(4H)-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 7；293 K；100 mM Bis-Tris, pH 7.0, 75-125 mM ammonium acetate, 50-75 mM potassium fluoride, 38-42% PEG400, 6% ethylene glycol, 1.5% 1,2-propaneiol	Resolution 3.70 Å R-free 0.307
6E67 Structure of beta2 adrenergic receptor fused to a Gs peptide Deposited 2018-07-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–161（160 aa） Fragment：beta-2 (UNP residues 1-232), lysozyme (UNP residues 2-161), GS (UNP residues 1024-1036)	Mutation：;M96T, M98T, N187E, C22A, C1054T, C1097A,M96T, M98T, N187E, C1054T, C1097A,M96T, M98T, N187E, C1054T, C1097A,M96T, M98T, N187E, C1054T, C1097A ;	P0G 8-[(1R)-2-{[1,1-dimethyl-2-(2-methylphenyl)ethyl]amino}-1-hydroxyethyl]-5-hydroxy-2H-1,4-benzoxazin-3(4H)-one × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 7；293 K；100 mM Bis-Tris, pH 7.0, 75-125 mM ammonium acetate, 50-75 mM potassium fluoride, 38-42% PEG400, 6% ethylene glycol, 1.5% 1,2-propaneiol	Resolution 3.70 Å R-free 0.307
6IGL Crystal Structure of human ETB receptor in complex with IRL1620 Deposited 2018-09-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–161（160 aa）	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	CIT CITRIC ACID × 1 SO4 SULFATE ION × 4 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 3	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 5；293 K；PEG 500DME, (NH4)2SO4 or NH4Cl	Resolution 2.70 Å R-free 0.241
6K41 cryo-EM structure of alpha2BAR-GoA complex Deposited 2019-05-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 2–161（160 aa）	Not recorded	CZX 4-[(1~{S})-1-(2,3-dimethylphenyl)ethyl]-1~{H}-imidazole × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6K42 cryo-EM structure of alpha2BAR-Gi1 complex Deposited 2019-05-23	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 2–161（160 aa）	Not recorded	CZX 4-[(1~{S})-1-(2,3-dimethylphenyl)ethyl]-1~{H}-imidazole × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
6KPC Crystal structure of an agonist bound GPCR Deposited 2019-08-15	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–161（160 aa）	Mutation：G78L,T127A,T153L,G210A,C54T,C97A,R242E,G304E	E3R 7-[(6aR,9R,10aR)-1-Hydroxy-9-(hydroxymethyl)-6,6-dimethyl-6a,7,8,9,10,10a-hexahydro-6H-benzo[c]chromen-3-yl]- 7-methyloctanenitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；293 K；100 mM HEPES sodium pH 7.0, 25% PEG 400, 220 mM Sodium sulfate decahydrate	Resolution 3.20 Å R-free 0.262
6LRY Crystal structure of human endothelin ETB receptor in complex with sarafotoxin S6b Deposited 2020-01-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–161（160 aa）	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 5；293 K；PEG 600, Ammonium sulfate	Resolution 3.00 Å R-free 0.304
6N48 Structure of beta2 adrenergic receptor bound to BI167107, Nanobody 6B9, and a positive allosteric modulator Deposited 2018-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–161（160 aa） Fragment：chimera of lysozyme and B2AR (UNP residues 29-234,263-348)	Mutation：M1096T, M1098T, N1187E	P0G 8-[(1R)-2-{[1,1-dimethyl-2-(2-methylphenyl)ethyl]amino}-1-hydroxyethyl]-5-hydroxy-2H-1,4-benzoxazin-3(4H)-one × 1 1WV (2S)-2,3-dihydroxypropyl (7Z)-tetradec-7-enoate × 1 KBY N-[(3R)-4-(4-tert-butylphenyl)-3-({2-[(4-methoxyphenyl)sulfanyl]-5-[methyl(propan-2-yl)sulfamoyl]benzene-1-carbonyl}amino)butanoyl]glycine × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 8；293 K；100 mM Tris-HCl, pH 8.0, 150-200 mM lithium acetate, 43-45% PEG400	Resolution 3.20 Å R-free 0.274
6NI3 B2V2R-Gs protein subcomplex of a GPCR-G protein-beta-arrestin mega-complex Deposited 2018-12-26	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain R 2–161（160 aa）	Not recorded	P0G 8-[(1R)-2-{[1,1-dimethyl-2-(2-methylphenyl)ethyl]amino}-1-hydroxyethyl]-5-hydroxy-2H-1,4-benzoxazin-3(4H)-one × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
7C2M Crystal structure of mycolic acid transporter MmpL3 from Mycobacterium smegmatis complexed with NITD-349 Deposited 2020-05-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–161（160 aa）	Mutation：C803T,C846A	FFU N-(4,4-dimethylcyclohexyl)-4,6-bis(fluoranyl)-1H-indole-2-carboxamide × 1 L6T alpha-D-glucopyranosyl 6-O-dodecyl-alpha-D-glucopyranoside × 5 MHA (CARBAMOYLMETHYL-CARBOXYMETHYL-AMINO)-ACETIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；293 K；15% (v/v) polyethylene glycol monomethyl ether 350 (PEGMME 350), 50 mM ADA (N-(2-Acetamido) iminodiacetic acid) (pH 6.5) and 10% (v/v) polyethylene glycol 2000 (PEG2000), protein concentration 5mg/ml, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.10 Å R-free 0.281
7C2N Crystal structure of mycolic acid transporter MmpL3 from Mycobacterium smegmatis complexed with SPIRO Deposited 2020-05-08	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–161（160 aa）	Mutation：C803T,C846A	L6T alpha-D-glucopyranosyl 6-O-dodecyl-alpha-D-glucopyranoside × 5 MHA (CARBAMOYLMETHYL-CARBOXYMETHYL-AMINO)-ACETIC ACID × 2 FG0 1'-(2,3-dihydro-1,4-benzodioxin-6-ylmethyl)spiro[6,7-dihydrothieno[3,2-c]pyran-4,4'-piperidine] × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；293 K；15% (v/v) polyethylene glycol monomethyl ether 350 (PEGMME 350), 50 mM ADA (N-(2-Acetamido) iminodiacetic acid) (pH 6.5) and 12.5% (v/v) polyethylene glycol 2000 (PEG2000), protein concentration 5mg/ml, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.82 Å R-free 0.273
7DDZ The Crystal Structure of Human Neuropeptide Y Y2 Receptor with JNJ-31020028 Deposited 2020-10-30	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–161（160 aa）	Not recorded	H46 ~{N}-[4-[4-[(1~{S})-2-(diethylamino)-2-oxidanylidene-1-phenyl-ethyl]piperazin-1-yl]-3-fluoranyl-phenyl]-2-pyridin-3-yl-benzamide × 1 FMN FLAVIN MONONUCLEOTIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；293.15 K；0.1 M HEPES, pH 7.0-7.5, 250-350 mM (NH4)2SO4, and 20-30% PEG500DME, or 0.1 M MES, pH 6.0-6.5, 380-420 mM NH4 tartrate, and 24-26% PEG500DME	Resolution 2.80 Å R-free 0.289
7KWA Structure of DCN1 bound to N-((4S,5S)-3-(aminomethyl)-7-ethyl-4-(4-fluorophenyl)-6-oxo-1-phenyl-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-b]pyridin-5-yl)-3-(trifluoromethyl)benzamide Deposited 2020-11-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–164（164 aa）	Not recorded	YHP N-[(4S,5S)-3-(aminomethyl)-7-ethyl-4-(4-fluorophenyl)-6-oxo-1-phenyl-4,5,6,7-tetrahydro-1H-pyrazolo[3,4-b]pyridin-5-yl]-3-(trifluoromethyl)benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；277 K；6% PEG3350, 0.2M NH4Br	Resolution 1.57 Å R-free 0.209

16 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A097J809_BPT4
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 242–401； UniProt 2–161

Endothelin receptor type B,Endolysin,Endothelin receptor type B

Homo sapiens

UniProt P24530

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 66–303 Chain A； UniProt 311–407	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	Endothelin-3 × 1 （P14138） OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 12 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 500DME, Ammonium citrate tribasic	Resolution 2.00 Å R-free 0.227

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6IGK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5X93 Human endothelin receptor type-B in complex with antagonist K-8794 Deposited 2017-03-05	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,D154A,K270A,C1054A,I1094R,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,D154A,K270A,C1054A,I1094R,S342A,I381A,C396A,C400A,C405A	K87 3-[6-[(4-tert-butylphenyl)sulfonylamino]-5-(2-methoxyphenoxy)-2-pyrimidin-2-yl-pyrimidin-4-yl]oxy-N-(2,6-dimethylphenyl)propanamide × 1 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 11 CLR CHOLESTEROL × 1 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 500 DME, (NH4)2SO4, MOPS	Resolution 2.20 Å R-free 0.239
5XPR Human endothelin receptor type-B in complex with antagonist bosentan Deposited 2017-06-04	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,K270A,C1054A,I1094R,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,K270A,C1054A,I1094R,S342A,I381A,C396A,C400A,C405A	K86 4-tert-butyl-N-[6-(2-hydroxyethyloxy)-5-(2-methoxyphenoxy)-2-pyrimidin-2-yl-pyrimidin-4-yl]benzenesulfonamide × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 500 DME, Na2SO4, MOPS	Resolution 3.60 Å R-free 0.297
6IGL Crystal Structure of human ETB receptor in complex with IRL1620 Deposited 2018-09-25	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	CIT CITRIC ACID × 1 SO4 SULFATE ION × 4 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 3	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 5；293 K；PEG 500DME, (NH4)2SO4 or NH4Cl	Resolution 2.70 Å R-free 0.241
6K1Q Human endothelin receptor type-B in complex with inverse agonist IRL2500 Deposited 2019-05-11	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：;R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A,R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A,R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A ; Mutation：;R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A,R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A,R124Y, K270A,C97A, I137R,S342A, I381A, C396A, C400A, C405A ;	D2U (2~{S})-2-[[(2~{R})-2-[(3,5-dimethylphenyl)carbonyl-methyl-amino]-3-(4-phenylphenyl)propanoyl]amino]-3-(1~{H}-indol-3-yl)propanoic acid × 1 PO4 PHOSPHATE ION × 4 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 8	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 7.5；293 K；30% PEG300, 150 mM NaH2PO4,10 mM TCEP, 100 mM Bis-tris	Resolution 2.70 Å R-free 0.265
6LRY Crystal structure of human endothelin ETB receptor in complex with sarafotoxin S6b Deposited 2020-01-16	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 66–303（238 aa） Chain A 311–407（97 aa）	Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A Mutation：R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 5；293 K；PEG 600, Ammonium sulfate	Resolution 3.00 Å R-free 0.304
8HBD Cryo-EM structure of IRL1620-bound ETBR-Gi complex Deposited 2022-10-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 27–424（398 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.04 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.99 Å
8HCX Cryo-EM structure of Endothelin1-bound ETBR-Gq complex Deposited 2022-11-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 27–424（398 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8XVE Cryo-EM structure of ETBR bound with BQ3020 Deposited 2024-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 67–406（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8XVH Cryo-EM structure of ETBR bound with Endothelin1 Deposited 2024-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 67–406（340 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
8XWP Cryo-EM structure of ET-1 bound ETBR-DNGI complex Deposited 2024-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 66–407（342 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.21 Å
8XWQ Cryo-EM structure of ET-1 bound ETBR-DNGI complex Deposited 2024-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain R 66–407（342 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
8ZRT Cryo-EM structure focused on the receptor of the ET-1 bound ETBR-DNGI complex Deposited 2024-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 66–407（342 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.62 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	EDNRB_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–241； UniProt 66–303 Author chain A； PDBConstruct 402–498； UniProt 311–407

Endothelin-3

OrganismNot specified

UniProt P14138

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 97–117	Not recorded	Endothelin receptor type B,Endolysin,Endothelin receptor type B × 1 （P24530,A0A097J809） OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 12 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：LIPIDIC CUBIC PHASE；pH 6；293 K；PEG 500DME, Ammonium citrate tribasic	Resolution 2.00 Å R-free 0.227

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	EDN3_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–21； UniProt 97–117

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6igk
Deposition date deposition_date	2018-09-25
Structure title title	Crystal Structure of human ETB receptor in complex with Endothelin-3
Keywords keywords	alpha helical, SIGNALING PROTEIN-PROTEIN BINDING complex; SIGNALING PROTEIN/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	31.33 Å
Radius of gyration Rg (electron density) rg_electron	30.33 Å
Forward intensity I(0) i0	45754100.00
Molecular weight molecular_weight	59848.0 kDa
Excluded volume excluded_volume	77915 Å³
Envelope volume envelope_volume	95475 Å³
Hydration-shell volume shell_volume	27982 Å³
Envelope diameter envelope_diameter	107.4 Å
Shell Rg shell_rg	35.24 Å
Envelope Rg envelope_rg	30.28 Å
Shape Rg shape_rg	30.33 Å
Total Rg total_rg	30.85 Å
Total atoms total_atoms	4207
Residues n_residues	492
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	101.1 Å
Rg (real space) rg_real	31.61 Å
Rg uncertainty (real space) rg_real_error	1.08 Å
I(0) (real space) i0_real	4.5750e+07
I(0) uncertainty (real space) i0_real_error	7.5280e+05
Rg (reciprocal space) rg_reciprocal	31.50 Å
I(0) (reciprocal space) i0_reciprocal	45750000.0000
Solution quality estimate total_estimate	0.7698
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	23.8 Å
Skewness Skewness skewness	0.406
Kurtosis Kurtosis kurtosis	-0.668
Angular range angular_range	— – 0.2550 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	10830000.0000
Real-space data points n_real_points	52
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.802; Stabil: 0.998; Sysdev: 1.000; Positv: 1.000; Valcen: 0.602; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Endothelin receptor type B,Endolysin,Endothelin receptor type B
Molecular weight formula_weight	55956.7 kDa
EC 编号 ec_number	3.2.1.17
Mutation mutation	R124Y,D154A,K270A,C1052T,C1095A,S342A,I381A,C396A,C400A,C405A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4385

GGGLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLYIIYKNKCMRNGPNILIASLALGDLLHIVIAIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYATAKDWWLFSFYFCLPLAITAFFYTLMTCEMLRKNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLNDHLKQRREVAKTVFCLVLVFALCWLPLHLARILKLTLYNQNDPNRCELLSFLLVLDYIGINMASLNSCANPIALYLVSKRFKNAFKSALCCWAQS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Endothelin-3
Molecular weight formula_weight	2650.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

CTCFTYKDKECVYYCHLDIIW

Entity 3 Entity 3 non-polymer

Description description	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate
Molecular weight formula_weight	356.5 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 4 Entity 4 non-polymer

Description description	CITRIC ACID
Molecular weight formula_weight	192.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	175

▶

8. Citations (1)

▶

Unit-cell length a length_a	65.550 Å
Unit-cell length b length_b	172.280 Å
Unit-cell length c length_c	121.330 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	49.599 Å
R factor r_factor	0.1853
R_work r_work	0.1834
R_free r_free	0.2271

fit	/app/data/saxs_computation/ig/6igk/6igk.fit
pddf	/app/data/pr_computation/ig/6igk/6igk.pr.out
profile	/app/data/saxs_computation/ig/6igk/6igk.dat

Crystal Structure of human ETB receptor in complex with Endothelin-3

1. Protein Identity and Related Structures Protein Identity & Related Structures

Endothelin receptor type B,Endolysin,Endothelin receptor type B

State in the Current Structure

Other States of the Same Protein in the Database

Endothelin receptor type B,Endolysin,Endothelin receptor type B

State in the Current Structure

Other States of the Same Protein in the Database

Endothelin-3

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)