6ipz

Fyn SH3 domain R96W mutant, crystallized with 18-crown-6

Method: X-RAY DIFFRACTION D_max: 43.5 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tyrosine-protein kinase Fyn

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain Z； UniProt 82–144	Fragment：UNP residues 82-144 Mutation：R96W	O4B 1,4,7,10,13,16-HEXAOXACYCLOOCTADECANE × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 4.6；295 K；0.08M Sodium acetate trihydrate pH 4.6, 1.6M Ammonium sulfate, 20%(v/v) Glycerol	Resolution 1.58 Å R-free 0.209

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6IPZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
10DJ Fyn Kinase Domain-Saracatinib Complex Structure Deposited 2026-01-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 263–537（275 aa）	Not recorded	H8H N-(5-CHLORO-1,3-BENZODIOXOL-4-YL)-7-[2-(4-METHYLPIPERAZIN-1-YL)ETHOXY]-5-(TETRAHYDRO-2H-PYRAN-4-YLOXY)QUINAZOLIN-4-AMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；4.0 M ammonium acetate, 0.1 M sodium acetate trihydrate, pH 4.6	Resolution 2.22 Å R-free 0.268
10DJ Fyn Kinase Domain-Saracatinib Complex Structure Deposited 2026-01-13	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 263–537（275 aa）	Not recorded	H8H N-(5-CHLORO-1,3-BENZODIOXOL-4-YL)-7-[2-(4-METHYLPIPERAZIN-1-YL)ETHOXY]-5-(TETRAHYDRO-2H-PYRAN-4-YLOXY)QUINAZOLIN-4-AMINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；4.0 M ammonium acetate, 0.1 M sodium acetate trihydrate, pH 4.6	Resolution 2.22 Å R-free 0.268
1A0N NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE COMPLEXED WITH THE SYNTHETIC PEPTIDE P2L CORRESPONDING TO RESIDUES 91-104 OF THE P85 SUBUNIT OF PI3-KINASE, FAMILY OF 25 STRUCTURES Deposited 1997-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 79–147（69 aa） Fragment：SH3 DOMAIN, RESIDUES 82 - 148	Mutation：N-TERMINAL GS FROM EXPRESSION SYSTEM	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1AOT NMR STRUCTURE OF THE FYN SH2 DOMAIN COMPLEXED WITH A PHOSPHOTYROSYL PEPTIDE, MINIMIZED AVERAGE STRUCTURE Deposited 1997-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 142–247（106 aa） Fragment：SH2 DOMAIN	Mutation：C97S, C98S, C104S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；293 K	Resolution not provided
1AOU NMR STRUCTURE OF THE FYN SH2 DOMAIN COMPLEXED WITH A PHOSPHOTYROSYL PEPTIDE, 22 STRUCTURES Deposited 1997-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 142–247（106 aa） Fragment：SH2 DOMAIN	Mutation：C97S, C98S, C104S	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；293 K	Resolution not provided
1AVZ V-1 NEF PROTEIN IN COMPLEX WITH WILD TYPE FYN SH3 DOMAIN Deposited 1997-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 84–140（57 aa） Fragment：SRC-HOMOLOGY 3 DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.9；pH 8.9	Resolution 3.00 Å R-free 0.270
1AZG NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE KINASE COMPLEXED WITH THE SYNTHETIC PEPTIDE P2L CORRESPONDING TO RESIDUES 91-104 OF THE P85 SUBUNIT OF PI3-KINASE, MINIMIZED AVERAGE (PROBMAP) STRUCTURE Deposited 1997-11-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 81–147（67 aa） Fragment：SH3 DOMAIN, RESIDUES 82 - 148	Mutation：N-TERMINAL GS FROM EXPRESSION SYSTEM	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1EFN HIV-1 NEF PROTEIN IN COMPLEX WITH R96I MUTANT FYN SH3 DOMAIN Deposited 1996-06-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 85–142（58 aa） Fragment：SH3 DOMAIN, RESIDUES 85-141 Chain C 85–142（58 aa） Fragment：SH3 DOMAIN, RESIDUES 85-141	Mutation：R96I Mutation：R96I	PBM TRIMETHYL LEAD ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å R-free 0.282
1FYN PHOSPHOTRANSFERASE Deposited 1995-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 80–141（62 aa） Fragment：SH3 DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1G83 CRYSTAL STRUCTURE OF FYN SH3-SH2 Deposited 2000-11-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 81–245（165 aa） Fragment：SH3 AND SH2 DOMAIN	Mutation：C238S, C239S, C245S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；295 K；PEG 8000, sodium tartrate, TRIS , pH 6.0, VAPOR DIFFUSION, temperature 295.0K	Resolution 2.60 Å R-free 0.277
1G83 CRYSTAL STRUCTURE OF FYN SH3-SH2 Deposited 2000-11-16	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 81–245（165 aa） Fragment：SH3 AND SH2 DOMAIN	Mutation：C238S, C239S, C245S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6；295 K；PEG 8000, sodium tartrate, TRIS , pH 6.0, VAPOR DIFFUSION, temperature 295.0K	Resolution 2.60 Å R-free 0.277
1M27 Crystal structure of SAP/FynSH3/SLAM ternary complex Deposited 2002-06-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 83–143（61 aa） Fragment：SH3 domain (residues 82-143)	Not recorded	FLC CITRATE ANION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；297 K；Tartrate, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 297K	Resolution 2.50 Å R-free 0.266
1NYF NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE, MINIMIZED AVERAGE (PROBMAP) STRUCTURE Deposited 1996-04-22	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 81–147（67 aa） Fragment：SH3 DOMAIN, RESIDUES 82 - 148	Mutation：INS(GS-T82)	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1NYG NMR STUDY OF THE SH3 DOMAIN FROM FYN PROTO-ONCOGENE TYROSINE KINASE, FAMILY OF 20 STRUCTURES Deposited 1996-04-22	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 81–147（67 aa） Fragment：SH3 DOMAIN, RESIDUES 82 - 148	Mutation：INS(GS-T82)	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1SHF CRYSTAL STRUCTURE OF THE SH3 DOMAIN IN HUMAN FYN; COMPARISON OF THE THREE-DIMENSIONAL STRUCTURES OF SH3 DOMAINS IN TYROSINE KINASES AND SPECTRIN Deposited 1993-05-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 83–141（59 aa） Chain B 83–141（59 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
1ZBJ Inferential Structure Determination of the Fyn SH3 domain using NOESY data from a 15N,H2 enriched protein Deposited 2005-04-08	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–141（59 aa） Fragment：SH3 domain, Residues 83-141	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
2DQ7 Crystal Structure of Fyn kinase domain complexed with staurosporine Deposited 2006-05-23	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain X 261–537（277 aa） Fragment：Fyn, Protein kinase	Non-standard monomer：Yes (specific site not provided by mmCIF)	STU STAUROSPORINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；277 K；1.15M ammonium sulfate, 0.2M NaCl, 0.1M imidazole, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K	Resolution 2.80 Å R-free 0.281
2MQI human Fyn SH2 free state Deposited 2014-06-20	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 148–248（101 aa） Fragment：UNP residues 149-248	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 50；Pressure ambient NMR sample composition 0.8-1.4 mM [U-13C; U-15N] FynSH2, 50 mM sodium phosphate, 5 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2MRJ Structure of Fyn protein SH2 bound Deposited 2014-07-09	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 148–248（101 aa） Fragment：UNP residues 149-248	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 0；Pressure ambient NMR sample composition 1 mM [U-99% 13C; U-99% 15N] FynSH2 bound, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
2MRK Fyn SH2 domain in complex with the natural inhibitory phosphotyrosine peptide Deposited 2014-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 149–248（100 aa） Fragment：UNP residues 149-248 Chain B 528–537（10 aa） Fragment：UNP residues 528-537	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 0；Pressure ambient NMR sample composition 0.93 mM [U-99% 13C; U-99% 15N] protein_1, 1.2 mM protein_2, 93% H2O/7% D2O \| 93% H2O/7% D2O	Resolution not provided
3H0F Crystal structure of the human Fyn SH3 R96W mutant Deposited 2009-04-09	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 73–142（70 aa） Fragment：SH3 domain, UNP residues 73-142	Mutation：R96W	PG5 1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.1；277 K；2.0M ammonium sulphate, 2% PEG 400, 0.1M Tris, pH 9.1, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.61 Å R-free 0.282
3H0H human Fyn SH3 domain R96I mutant, crystal form I Deposited 2009-04-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 73–142（70 aa） Fragment：SH3 domain, UNP residues 73-142	Mutation：R96I	PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；291 K；0.5M ammonium sulphate, 0.1M sodium citrate, 1.0M lithium sulphate, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 1.76 Å R-free 0.222
3H0I human Fyn SH3 domain R96I mutant, crystal form II Deposited 2009-04-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 73–142（70 aa） Fragment：SH3 domain, UNP residues 73-142	Mutation：R96I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；291 K；0.2M ammonium acetate, 0.1M TRIS, 30% v/v MPD, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.20 Å R-free 0.243
3H0I human Fyn SH3 domain R96I mutant, crystal form II Deposited 2009-04-09	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 73–142（70 aa） Fragment：SH3 domain, UNP residues 73-142	Mutation：R96I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；291 K；0.2M ammonium acetate, 0.1M TRIS, 30% v/v MPD, pH 5.6, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.20 Å R-free 0.243
3UA6 Crystal Structure of the Human Fyn SH3 domain Deposited 2011-10-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 81–143（63 aa） Fragment：SH3 domain (UNP residues 81-143)	Not recorded	GOL GLYCEROL × 2 FMT FORMIC ACID × 5 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；5.5 M sodium formate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.85 Å R-free 0.246
3UA6 Crystal Structure of the Human Fyn SH3 domain Deposited 2011-10-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 81–143（63 aa） Fragment：SH3 domain (UNP residues 81-143)	Not recorded	FMT FORMIC ACID × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；5.5 M sodium formate, 0.1 M MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.85 Å R-free 0.246
3UA7 Crystal Structure of the Human Fyn SH3 domain in complex with a peptide from the Hepatitis C virus NS5A-protein Deposited 2011-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 81–143（63 aa） Fragment：SH3 domain (UNP residues 81-143)	Not recorded	GOL GLYCEROL × 1 CL CHLORIDE ION × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；4 M sodium formate, 10 mM zinc chloride, 0.1 M Tris, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.231
3UA7 Crystal Structure of the Human Fyn SH3 domain in complex with a peptide from the Hepatitis C virus NS5A-protein Deposited 2011-10-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 81–143（63 aa） Fragment：SH3 domain (UNP residues 81-143)	Not recorded	ZN ZINC ION × 1 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；4 M sodium formate, 10 mM zinc chloride, 0.1 M Tris, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.231
3UA7 Crystal Structure of the Human Fyn SH3 domain in complex with a peptide from the Hepatitis C virus NS5A-protein Deposited 2011-10-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 81–143（63 aa） Fragment：SH3 domain (UNP residues 81-143)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；4 M sodium formate, 10 mM zinc chloride, 0.1 M Tris, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.231
3UA7 Crystal Structure of the Human Fyn SH3 domain in complex with a peptide from the Hepatitis C virus NS5A-protein Deposited 2011-10-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 81–143（63 aa） Fragment：SH3 domain (UNP residues 81-143)	Not recorded	ZN ZINC ION × 1 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；4 M sodium formate, 10 mM zinc chloride, 0.1 M Tris, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.50 Å R-free 0.231
4D8D Crystal structure of HIV-1 NEF Fyn-SH3 R96W variant Deposited 2012-01-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 84–141（58 aa） Fragment：SRC-HOMOLOGY 3 DOMAIN (UNP Residues 84-141)	Mutation：R96W	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；293 K；0.3 M sodium potassium tartrate, 0.5 M bicine buffer , 1cmc D-octylglucopyranoside, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.52 Å R-free 0.238
4D8D Crystal structure of HIV-1 NEF Fyn-SH3 R96W variant Deposited 2012-01-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 84–141（58 aa） Fragment：SRC-HOMOLOGY 3 DOMAIN (UNP Residues 84-141)	Mutation：R96W	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.4；293 K；0.3 M sodium potassium tartrate, 0.5 M bicine buffer , 1cmc D-octylglucopyranoside, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.52 Å R-free 0.238
4EIK Crystal Structure of the Human Fyn SH3 domain in complex with the synthetic peptide VSL12 Deposited 2012-04-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 81–143（63 aa） Fragment：SH3 domain (UNP residues 81-143)	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；5.5 M sodium formate, 0.1 M MES, pH 6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.60 Å R-free 0.195
4U17 Swapped dimer of the human Fyn-SH2 domain Deposited 2014-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: Dimeric	Chain A 148–248（101 aa） Fragment：Fyn-SH2 domain (UNP residues 148-248) Chain C 148–248（101 aa） Fragment：Fyn-SH2 domain (UNP residues 148-248)	Not recorded	PO4 PHOSPHATE ION × 5 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM sodium phosphate pH 6.5	Resolution 1.99 Å R-free 0.255
4U17 Swapped dimer of the human Fyn-SH2 domain Deposited 2014-07-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: Dimeric	Chain B 148–248（101 aa） Fragment：Fyn-SH2 domain (UNP residues 148-248)	Not recorded	PO4 PHOSPHATE ION × 4 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；50 mM sodium phosphate pH 6.5	Resolution 1.99 Å R-free 0.255
4U1P Human Fyn-SH2 domain in complex with a synthetic high-affinity phospho-peptide Deposited 2014-07-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: DIMERIC	Chain A 148–248（101 aa） Fragment：Human Fyn-SH2 domain, RESIDUES 148-248	Not recorded	15P POLYETHYLENE GLYCOL (N=34) × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M MOPS/Na HEPES pH 7.5, 0.12 M monosaccharide mixture, PEG 1000, 12.5%(w/v) PEG 3350 and 12.5%(v/v) MPD	Resolution 1.40 Å R-free 0.188
4ZNX Crystal structure of the Fyn-SH3 domain in complex with the high affinity peptide APP12 Deposited 2015-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 84–141（58 aa） Fragment：SH3 DOMAIN, UNP residues 84-141 Chain B 84–141（58 aa） Fragment：SH3 DOMAIN, UNP residues 84-141 Chain C 84–141（58 aa） Fragment：SH3 DOMAIN, UNP residues 84-141 Chain D 84–141（58 aa） Fragment：SH3 DOMAIN, UNP residues 84-141	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；4 M sodium formate, 0.1 M Hepes	Resolution 2.10 Å R-free 0.222
5ZAU Complex of the human FYN SH3 and monobody binder Deposited 2018-02-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 85–141（57 aa） Fragment：UNP residues 85-141	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 8；298 K；Ionic strength (raw mmCIF value) 300；Pressure 1 NMR sample composition 1 mM [U-99% 13C; U-99% 15N] FYN SH3 domain, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-99% 13C; U-99% 15N] Monobody Binder, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-99% 15N; U-98% 2H] FYN SH3 domain, 1.5 mM Unlabeled Monobody Binder, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.2 mM [U-99% 15N] FYN SH3 domain, 1 mM Unlabeled Monobody Binder, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.2 mM [U-99% 15N] Monobody Binder, 1 mM Unlabeled FYN SH3 domain, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6IPY His-tagged Fyn SH3 domain R96I mutant Deposited 2018-11-05	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 82–144（63 aa） Fragment：UNP residues 82-144	Mutation：R96I	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 3.5；295 K；0.1M Citric acid pH 3.5 and 25%(w/v) Polyethylene glycol 3,350	Resolution 1.34 Å R-free 0.201
7A2J Crystal structure of the Fyn SH3 domain in space group C21 at pH 7.5 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–142（60 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；4.5M sodium formate, 0.1M Hepes	Resolution 1.50 Å R-free 0.247
7A2J Crystal structure of the Fyn SH3 domain in space group C21 at pH 7.5 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 83–142（60 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；4.5M sodium formate, 0.1M Hepes	Resolution 1.50 Å R-free 0.247
7A2K Crystal structure of the Fyn SH3 domain in space group P1 at pH 7.5 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–142（60 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；4.5M sodium formate, 0.1M Hepes	Resolution 1.50 Å R-free 0.236
7A2K Crystal structure of the Fyn SH3 domain in space group P1 at pH 7.5 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 83–142（60 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；4.5M sodium formate, 0.1M Hepes	Resolution 1.50 Å R-free 0.236
7A2K Crystal structure of the Fyn SH3 domain in space group P1 at pH 7.5 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 83–142（60 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；4.5M sodium formate, 0.1M Hepes	Resolution 1.50 Å R-free 0.236
7A2K Crystal structure of the Fyn SH3 domain in space group P1 at pH 7.5 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 83–142（60 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；4.5M sodium formate, 0.1M Hepes	Resolution 1.50 Å R-free 0.236
7A2L Crystal structure of the Fyn SH3 domain mutant E129Q in space group C21 at pH 4.0 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–142（60 aa）	Mutation：E129Q	FMT FORMIC ACID × 2 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；3.5M sodium formate, 0.1M sodium acetate	Resolution 1.90 Å R-free 0.261
7A2L Crystal structure of the Fyn SH3 domain mutant E129Q in space group C21 at pH 4.0 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 83–142（60 aa）	Mutation：E129Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；3.5M sodium formate, 0.1M sodium acetate	Resolution 1.90 Å R-free 0.261
7A2M Crystal structure of the Fyn SH3 domain A95S-D99T mutant in C21 space group Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–142（60 aa）	Mutation：A95S D99T	NA SODIUM ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；4.5 M sodium formate, 0.1 sodium acetate	Resolution 1.50 Å R-free 0.255
7A2M Crystal structure of the Fyn SH3 domain A95S-D99T mutant in C21 space group Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 83–142（60 aa）	Mutation：A95S D99T	NA SODIUM ION × 1 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；4.5 M sodium formate, 0.1 sodium acetate	Resolution 1.50 Å R-free 0.255
7A2N Crystal structure of the Fyn SH3 domain A95S-D99T mutant in space group P21 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–142（60 aa）	Mutation：A95S D99T	FMT FORMIC ACID × 1 NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；4.5 M sodium formate, 0.1 sodium acetate	Resolution 1.40 Å R-free 0.203
7A2N Crystal structure of the Fyn SH3 domain A95S-D99T mutant in space group P21 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 83–142（60 aa）	Mutation：A95S D99T	FMT FORMIC ACID × 2 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；4.5 M sodium formate, 0.1 sodium acetate	Resolution 1.40 Å R-free 0.203
7A2N Crystal structure of the Fyn SH3 domain A95S-D99T mutant in space group P21 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 83–142（60 aa）	Mutation：A95S D99T	FMT FORMIC ACID × 3 NA SODIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；4.5 M sodium formate, 0.1 sodium acetate	Resolution 1.40 Å R-free 0.203
7A2N Crystal structure of the Fyn SH3 domain A95S-D99T mutant in space group P21 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 83–142（60 aa）	Mutation：A95S D99T	FMT FORMIC ACID × 3 NA SODIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；4.5 M sodium formate, 0.1 sodium acetate	Resolution 1.40 Å R-free 0.203
7A2O Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 4.5 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–142（60 aa）	Mutation：L112V S114N S115T E121L R123H	PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；5% PEG 300, 1.5 ammonium sulfate, 0.1M sodium acetate	Resolution 0.94 Å R-free 0.175
7A2P Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 5.0 with PEG Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–143（61 aa）	Mutation：L112V S114N S115T E121L R123H	PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；298 K；5% PEG 300, 2.0 ammonium sulfate, 0.1M sodium acetate	Resolution 0.90 Å R-free 0.150
7A2Q Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 3.0 with PEG Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–143（61 aa）	Mutation：L112V S114N S115T E121L R123H	PG4 TETRAETHYLENE GLYCOL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；298 K；5% PEG 300, 5 mM beta-cyclodextrin, 2.0 ammonium sulfate, 0.1M sodium citrate	Resolution 0.94 Å R-free 0.161
7A2R Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 6.0 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–143（61 aa）	Mutation：L112V S114N S115T E121L R123H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.5 ammonium sulfate, 0.1M MES	Resolution 1.05 Å R-free 0.173
7A2S Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 5.0 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–143（61 aa）	Mutation：L112V S114N S115T E121L R123H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；298 K；2.0 ammonium sulfate, 0.1M sodium acetate	Resolution 1.02 Å R-free 0.175
7A2T Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 4.0 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–143（61 aa）	Mutation：L112V S114N S115T E121L R123H	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；1 ammonium sulfate, 0.1M sodium acetate	Resolution 1.22 Å R-free 0.203
7A2U Crystal structure of the Fyn SH3 domain L112V-S114N-S115T at pH 4.5 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–142（60 aa）	Mutation：L112V S114N S115T	ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；298 K；1.5 M ammonium sulfate, 0.1 sodium acetate	Resolution 1.70 Å R-free 0.200
7A2V Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E129Q at pH 4.0 Deposited 2020-08-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 83–142（60 aa）	Mutation：L112V S114N S115T E129Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；1.5 M ammonium sulfate, 0.1 sodium acetate	Resolution 1.81 Å R-free 0.220
7A2W Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex with VSL12 at pH 3.0 Deposited 2020-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 83–142（60 aa） Fragment：SH3 domain	Mutation：L112V S114N S115T E121L R123H	CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 3；298 K；0.5 M ammonium sulfate, 0.1 sodium citrate	Resolution 0.99 Å R-free 0.151
7A2X Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex with VSL12 at pH 5.0 Deposited 2020-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 83–142（60 aa） Fragment：SH3 domain	Mutation：L112V S114N S115T E121L R123H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；298 K；0.5 M ammonium sulfate, 0.1 sodium acetate	Resolution 0.92 Å R-free 0.148
7A2Y Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex with VSL12 at pH 4.0 Deposited 2020-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 83–142（60 aa） Fragment：SH3 domain	Mutation：L112V S114N S115T E121L R123H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4；298 K；0.5 M ammonium sulfate, 0.1 sodium acetate	Resolution 0.97 Å R-free 0.146
7A2Z Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex with VSL12 at pH 6.0 Deposited 2020-08-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 83–142（60 aa） Fragment：SH3 domain	Mutation：L112V S114N S115T E121L R123H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1 M ammonium sulfate, 0.1 sodium acetate	Resolution 1.14 Å R-free 0.195
8KDX Tau-S214 Phosphorylation Inhibits Fyn Kinase Interaction and Increases the Decay Time of NMDAR-mediated Current Deposited 2023-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 85–142（58 aa） Fragment：FynSH3 domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293.15 K；1.2 M Sodium citrate tribasic dehydrated, 0.1 M Tris buffer pH8.5	Resolution 1.01 Å R-free 0.185
9GHK Crystal structure of Fyn SH3 domain/tau 214-220 peptide complex Deposited 2024-08-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 80–143（64 aa） Chain B 80–143（64 aa）	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M NaCl, 0.4 M NaH2PO4, 1.5 M K2HPO4, 0.1 M imidazole pH 7.5	Resolution 1.42 Å R-free 0.218
9PGZ X-ray crystal structure of SRD42 Deposited 2025-07-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 87–141（55 aa）	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；279 K；0.5 M Sodium chloride, 0.01 M Hexadecyltrimethylammonium bromide	Resolution 2.60 Å R-free 0.247

50 other PDB entries and 68 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FYN_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain Z； PDBConstruct 8–70； UniProt 82–144

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6ipz
Deposition date deposition_date	2018-11-05
Structure title title	Fyn SH3 domain R96W mutant, crystallized with 18-crown-6
Keywords keywords	kinase, SH3 domain, 18-crown-6, crown ether, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	12.83 Å
Radius of gyration Rg (electron density) rg_electron	11.35 Å
Forward intensity I(0) i0	1258830.00
Molecular weight molecular_weight	7599.0 kDa
Excluded volume excluded_volume	9543 Å³
Envelope volume envelope_volume	10641 Å³
Hydration-shell volume shell_volume	8286 Å³
Envelope diameter envelope_diameter	41.6 Å
Shell Rg shell_rg	16.67 Å
Envelope Rg envelope_rg	11.93 Å
Shape Rg shape_rg	11.29 Å
Total Rg total_rg	12.95 Å
Total atoms total_atoms	1040
Residues n_residues	63
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	43.5 Å
Rg (real space) rg_real	12.78 Å
Rg uncertainty (real space) rg_real_error	0.30 Å
I(0) (real space) i0_real	1.2590e+06
I(0) uncertainty (real space) i0_real_error	1.4930e+04
Rg (reciprocal space) rg_reciprocal	12.78 Å
I(0) (reciprocal space) i0_reciprocal	1259000.0000
Solution quality estimate total_estimate	0.8583
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	16.0 Å
Skewness Skewness skewness	0.269
Kurtosis Kurtosis kurtosis	-0.083
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	286800.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.738; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.943

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tyrosine-protein kinase Fyn
Molecular weight formula_weight	7849.6 kDa
EC 编号 ec_number	2.7.10.2
Mutation mutation	R96W
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z
Atom count atom_count	1079

LLVPRGSTGVTLFVALYDYEAWTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSI

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	1,4,7,10,13,16-HEXAOXACYCLOOCTADECANE
Molecular weight formula_weight	264.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	23

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d6ipzz1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.2 — SH3-domain
Family Family family	b.34.2.1 — SH3-domain

Domain ID domain_id	d6ipzz2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (1 domains)

Domain ID domain_id	6ipzZ00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	40 — SH3 Domains

▶

8. Citations (1)

▶

Unit-cell length a length_a	51.490 Å
Unit-cell length b length_b	51.490 Å
Unit-cell length c length_c	51.850 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.576 Å
Low-resolution limit resolution_low	36.536 Å
R factor r_factor	0.1912
R_work r_work	0.1902
R_free r_free	0.2088

fit	/app/data/saxs_computation/ip/6ipz/6ipz.fit
pddf	/app/data/pr_computation/ip/6ipz/6ipz.pr.out
profile	/app/data/saxs_computation/ip/6ipz/6ipz.dat