6k15

RSC substrate-recruitment module

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromatin structure-remodeling complex subunit RSC7

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC7_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain F； PDBConstruct 1–435； UniProt 1–435

Chromatin structure-remodeling complex protein RSC8

OrganismNot specified

UniProt P43609

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC8_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–557； UniProt 1–557 Author chain H； PDBConstruct 1–557； UniProt 1–557

Chromatin structure-remodeling complex subunit RSC9

OrganismNot specified

UniProt Q03124

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC9_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain M； PDBConstruct 1–581； UniProt 1–581

Chromatin structure-remodeling complex protein RSC6

OrganismNot specified

UniProt P25632

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC6_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain I； PDBConstruct 1–483； UniProt 1–483

Chromatin structure-remodeling complex subunit SFH1

OrganismNot specified

UniProt Q06168

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SFH1_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–426； UniProt 1–426

Chromatin structure-remodeling complex protein RSC58

OrganismNot specified

UniProt Q07979

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC58_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain A； PDBConstruct 1–502； UniProt 1–502

Nuclear protein STH1/NPS1

OrganismNot specified

UniProt P32597

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STH1_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain J； PDBConstruct 1–1359； UniProt 1–1359

High temperature lethal protein 1

OrganismNot specified

UniProt Q9URQ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HTL1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–78； UniProt 1–78

Chromatin structure-remodeling complex protein RSC30

OrganismNot specified

UniProt P38781

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC30_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 1–883； UniProt 1–883

Chromatin structure-remodeling complex protein RSC3

OrganismNot specified

UniProt Q06639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC3_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 1–885； UniProt 1–885

Chromatin structure-remodeling complex subunit RSC4

OrganismNot specified

UniProt Q02206

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC4_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain X； PDBConstruct 1–625； UniProt 1–625

Chromatin structure-remodeling complex subunit RSC2

OrganismNot specified

UniProt Q06488

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC8 × 2 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC2_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–889； UniProt 1–889

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6k15
Deposition date deposition_date	2019-05-09
Structure title title	RSC substrate-recruitment module
Keywords keywords	chromatin remodeler, SWI/SNF family, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6k15__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6k15__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6k15__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	56.67 Å
Rg (electron density)	56.75 Å
Total Rg	56.87 Å
Atom count	21486
Residues	2655
Excluded volume	384660 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6k15__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Chromatin structure-remodeling complex subunit RSC7
Molecular weight formula_weight	49716.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F
Atom count atom_count	21486

MSDSEGGLASEVEHEKRSRSTSNRPNYAIDTEDLDIDENDENEDDDYREEEANEGVNEEEISDEEEQINKSGRNKRRHVDEEEDLSEDKGVTRSRNRSKFKKPVFPGIDDAEENLNPLKVVNEEYVLPDDPEGETKITADGDLLGGREFLVRTFTLTEKGNRKFMLATEPARIVGFRDSYLFFQTHPNLYKFILNQTQKNDLIDRGVLPYSYRNRQIALVTARGVFKEFGAKIIRGGKHITDDYYASELRTKGNVIEGKLAGDPIDKSARALETMMYPASENGINPAKNQVEFFEHRPHGHMSNSNIIASGSKLSSTNWLYQHSAACSRFNSDLFYDRVKVLLVDQQGLRDAYTNILHIPESTQSTTVLGWRRSKNDSPSDTSIVYETVIHDNDLNKPKTGLSEIPKEIYEDVVDEDVLRAITEQQNFEKCNEYI

Entity 2 Entity 2 polymer

Description description	Chromatin structure-remodeling complex protein RSC8
Molecular weight formula_weight	63254.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,D

MSDTEKDKDVPMVDSHEATEEPPTTSTNTPSFPHLAQEQAKEESATLGAEVAHKKINYEQEAQKLEEKALRFLAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSLIGPSFTGHFQVVLDTPQGLKPFLPENVIKQEVEGGDGAEPQVKKEFPVNLTIKKNVYDSAQDFNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSDFIRLENNGNSVKKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIEDNYIREVVGSTLNGKGGDSRDGSVSGSKLMECVNDAVQTLLQGDDKLGKVSDKSREISEKYIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLSLSKQILDLNKSLEELNVSKKLVLISEQVDSGIQLVEKDQEGDDEDGNTATGHGVKRVGKEGEEVGEGDSIAKLQPQVYKPWSL

Entity 3 Entity 3 polymer

Description description	Chromatin structure-remodeling complex subunit RSC9
Molecular weight formula_weight	65289.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MNSLASNTPLNGTPVSEAPATSSEPVNMFETMVANPIKVSRLQSNGVLTGPAANTKSIHYSLANFNVFQSLPKETARGVDDLTRMEMALLSGIPEEIKWSLKKYLTYSNKAPYMISLRTLPDLLPLFKTFILPLERIVEGLNKSSICDSKAMDSLQMGLNALLILRNLAQDTDSVQILVKDREIKSFILFILKKFQCVATGDNKWQLYEGNATFFNELTHYTLDLMEAISSYIAPAMKDDHYFQTLVSILNYTKDRYMVISILRSLSRLLVRSKANEESAADNLDHKTLSLIVSFLLLECDSELIIASLDFLYQYILPGSQRITELFKSKECSLILEATLPNLLSYNIATPDYHLLQKHKIRLIKRLKPPAPKEPPNLSEDLFQQLFKLNEPLRSTAWLRCCFEPVQEAEFTQISLWRSYESKFGQPVRESGRKLLPAVEFIKNVSNAFNNAAAIVITDPVTGKKRFVIKGIQPRFKALGIADGERESQVPISALKSKFLNDSKEITPARQNSIPEVKFPQELSDVSKVACTFLCLLSNDTDDGAGSAFCQRIRPLVLHKLADIPPLTLALSEYMENTSGL

Entity 4 Entity 4 polymer

Description description	Chromatin structure-remodeling complex protein RSC6
Molecular weight formula_weight	54222.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MVTQTNPVPVTYPTDAYIPTYLPDDKVSNLADLKKLIEMDSRLDLYLTRRRLDTSINLPTNTKTKDHPPNKEMLRIYVYNTTESSPRSDSGTPADSGKTTWTLRIEGKLLHESANGKHPFSEFLEGVAVDFKRLKPLGMGKKRKRDSSLSLPLNLQQPEYNDQDSTMGDNDNGEDEDSAEAESREEIVDALEWNYDENNVVEFDGIDIKRQGKDNLRCSITIQLRGVDGGKVQYSPNLATLIGMQTGSVNDAVYSIYKYILINNLFVTEQTEAQDGSNDAEDSSNENNNKNGAGDDDGVEGSTPKDKPELGEVKLDSLLQKVLDTNAAHLPLMNVVQTVNKLVSPLPPIILDYTIDLSKDTTYGATTLDVDVSHILHQPQPQPNLQKEEETDAEDTAKLREITKLALQLNSSAQKYQFFHELSLHPRETLTHYLWSSKQNELVLQGDQYFNEDAARTSDIYSNNNNDRSLMGNISLLYSQGRL

Entity 5 Entity 5 polymer

Description description	Chromatin structure-remodeling complex subunit SFH1
Molecular weight formula_weight	48833.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSHQNQLIPQAYISNFHNRLTNEDDGIPIFTMAQQTRQHKRAKVVNYAEYDNDLFDEFNMNGSNFNNADTHYKDNAVSHENTPALTNGVTMDGSEYNVLENMNGADSIISNNKYDAGSNMVVESLSGLNSNNNASNGPSNKAQAQDIGNAVLPDLQDQHHNPFNILRYPKIRDTFINGKVVSPYRLNTDQETKANANSGEAIMIPITLDIEHMGHTIKDQFLWNYNDDSISPEEFASIYCKDLDMTSATLQTQIANIIKEQLKDLENIAATEIMSDLHVIINLTCNLQDRFFEDNFQWNLNDKSLTPERFATSIVQDLGLTREFIPLISQSLHETILKIKKDWVDGHLIQDHVPNDAAFGYLSGIRLDIDELGSNWCPRVEILTKEEIQKREIEKERNLRRLKRETDRLSRRGRRRLDDLETTMRM

Entity 6 Entity 6 polymer

Description description	Chromatin structure-remodeling complex protein RSC58
Molecular weight formula_weight	57871.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MTESVGGNKLVDFLVNVQSILNAASVKCHVVDESFPAKFFEKNPDKIYESYCKFIKNRSNSEGLIRNEDKLVLTTINKRFENGEYEPIQGGFYKLYHDIKLVCTILIHFYPQGTRNYQLVDKFYKFSSELLLRECCRIGIALTQTNNIKSRSGKLLSGNEMDEYDDDDATELDKIISYDFIKISMNYTVPISQTYQIRTKDMDLFSSIISKSNLDKRPHELPNTNFKINNVLPQTDIENEAPRLGFVGANTSNIPDPTLPPTEMMTRFLHPNWYALPTTVWLKYGNYNSWAPSFNENGTVVDSTTRGLIWLERIGYMDLYEKNEKKVKQEELLNTNEEGINRKQNDENNKNVDGKSNGVQDDGGDNDNDATIASANSESTENKEQFIIKLQNLYNWTPSNYIGDDEIENFRNGTPDKLVSDSLLKLKRLRKERILNKVLKPTTEERELYFKVKRILKEVILAKKVSKVPINNVRAFPVLQTNYNGSIPVVRAQPGRKRKHKK

Entity 7 Entity 7 polymer

Description description	Nuclear protein STH1/NPS1
Molecular weight formula_weight	156982.4 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MLQEQSELMSTVMNNTPTTVAALAAVAAASETNGKLGSEEQPEITIPKPRSSAQLEQLLYRYRAIQNHPKENKLEIKAIEDTFRNISRDQDIYETKLDTLRKSIDKGFQYDEDLLNKHLVALQLLEKDTDVPDYFLDLPDTKNDNTTAIEVDYSEKKPIKISADFNAKAKSLGLESKFSNATKTALGDPDTEIRISARISNRINELERLPANLGTYSLDDCLEFITKDDLSSRMDTFKIKALVELKSLKLLTKQKSIRQKLINNVASQAHHNIPYLRDSPFTAAAQRSVQIRSKVIVPQTVRLAEELERQQLLEKRKKERNLHLQKINSIIDFIKERQSEQWSRQERCFQFGRLGASLHNQMEKDEQKRIERTAKQRLAALKSNDEEAYLKLLDQTKDTRITQLLRQTNSFLDSLSEAVRAQQNEAKILHGEEVQPITDEEREKTDYYEVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDLLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESETNRDDDDKAELDDDELNDTLARSADEKILFDKIDKERMNQERADAKAQGLRVPPPRLIQLDELPKVFREDIEEHFKKEDSEPLGRIRQKKRVYYDDGLTEEQFLEAVEDDNMSLEDAIKKRREARERRRLRQNGTKENEIETLENTPEASETSLIENNSFTAAVDEETNADKETTASRSKRRSSRKKRTISIVTAEDKENTQEESTSQENGGAKVEEEVKSSSVEIINGSESKKKKPKLTVKIKLNKTTVLENNDGKRAEEKPESKSPAKKTAAKKTKTKSKSLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNEFTDEWFKEHSS

Entity 8 Entity 8 polymer

Description description	High temperature lethal protein 1
Molecular weight formula_weight	9192.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSQNNTISSMNPERAYNNVTLKNLTAFQLLSQRENICELLNLVESTERHNSIINPERQRMSLEEMKKMLDALKNERKK

Entity 9 Entity 9 polymer

Description description	Chromatin structure-remodeling complex protein RSC30
Molecular weight formula_weight	101448.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MMDMQVRKVRKPPACTQCRKRKIGCDRAKPICGNCVKYNKPDCFYPDGPGKMVAVPSASGMSTHGNGQGSNHFSQGNGVNQKNVMIQTQYPIMQTSIEAFNFSFNPSVDTAMQWTKAASYQNNNTNNNTAPRQNSSTVSSNVHGNTIVRSDSPDVPSMDQIREYNTRLQLVNAQSFDYTDNPYSFNVGINQDSAVFDLMTSPFTQEEVLIKEIDFLKNKLLDLQSLQLKSLKEKSNLNADNTTANKINKTGENSKKGKVDGKRAGFDHQTSRTSQSSQKYFTALTITDVQSLVQVKPLKDTPNYLFTKNFIIFRDHYLFKFYNILHDICHINQFKVSPPNNKNHQQYMEVCKVNFPPKAIIIETLNSESLNNLNIEEFLPIFDKTLLLEFVHNSFPNGDTCPSFSTVDLPLSQLTKLGELTVLLLLLNDSMTLFNKQAINNHVSALMNNLRLIRSQITLINLEYYDQETIKFIAITKFYESLYMHDDHKSSLDEDLSCLLSFQIKDFKLFHFLKKMYYSRHSLLGQSSFMVPAAENLSPIPASIDTNDIPLIANDLKLLETQAKLINILQGVPFYLPVNLTKIESLLETLTMGVSNTVDLYFHDNEVRKEWKDTLNFINTIVYTNFFLFVQNESSLSMAVQHSSNNNKTSNSERCAKDLMKIISNMHIFYSITFNFIFPIKSIKSFSSGNNRFHSNGKEFLFANHFIEILQNFIAITFAIFQRCEVILYDEFYKNLSNEEINVQLLLIHDKILEILKKIEIIVSFLRDEMNSNGSFKSIKGFNKVLNLIKYMLRFSKKKQNFARNSDNNNVTDYSQSAKNKNVLLKFPVSELNRIYLKFKEISDFLMEREVVQRSIIIDKDLESDNLGITTANFNDFYDAFYN

Entity 10 Entity 10 polymer

Description description	Chromatin structure-remodeling complex protein RSC3
Molecular weight formula_weight	101834.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MDIRGRKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFYPDVPGQYVPSSSSSSNTRQVANGPYLNSYYASRRVSKETAALLQKNPELASLEQIREYNTRLQLLNAQNQLNNRSSAANATLNQQHTQYIPKSVPSLESKPVTSANESSTPLNWVQGPAIFHMLTSPYTQDEIINHEMNFLKGRLLELQEITGKKITGVNLDLKQDSSAQMQSSHSNRNQEEFLTIKKRKLSEDGVTDGDGKPIPESERRPHLNEFKDLDPQFLDTNKVFNVFNSAISEEGRNRLWLLPKNINKSSIFQIQYLIERDPFLFKFFNDLNILIETQFNGPLHDLVASRNSIERNSGISQILKFPSQSITQTLINKYLSTITETNSILPILKPKRLLPIVEQLFPSNTINKPNSKDFETIFQVFSVTNDQLLNLGFITLCLLILFESLNSTVLIPLRDDEHLQLFNVLFNYLPLLKSNLTTLRFEIEKRSMCNIETLRFISLWKYYQFVMDTSSSSSFVIDYDEDMHMACLLSLNHETQNQSHILTWNFIFKNYCWRHLFLGQLPLLMSEPFTNSTPIIDPLLNNDFELIDFEVNLMKYLQSKDQQLSIDKIIQLIKLLKNKNIEVSQGCLTTPSIINNIMDSLIYRNSMLYLNFYLLLQFETLKNYAKFNEILEDFLELSRETLFFVFSNLANIKFAGHEFTFINKSIVVLQTLVLMLLALYQRSFDSSKRTNDANEISEQTDIHSNNDNSKRIKNKNVIHLIINKIAMLLSDYTKNCKKQNKLIENLIIKIKTISKYIKNLEENKVTTSADSNYSINNGFSGISAEQLIKLNHELSKISESLIKTDFYEQRKNSTVSNGVLGAAAPVDSDANSDTFGLTKENFNEVFEAIRS

Entity 11 Entity 11 polymer

Description description	Chromatin structure-remodeling complex subunit RSC4
Molecular weight formula_weight	72372.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MVVKKRKLATEAGGSDERPKYLPGKHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFDKFEFENYLAIGGGGPAAAGALAISALDNDIEPESNREDLIDQADYDFNHFEGLGNGYNRSLLTEDYLLNPNNFKKLIAKPETVQSEVKNERSTTSDIEKTNSLESEHLKIPKYNVIKSMQKEMQSLSEQHTMEYKPYKLIQQIYIFSSKNLYSQATKPLLGSRPSCNQNWVEYIFNGNELSQNENAFSFMLQPMQTFLTLQSHLTSSLKDTETLLTINKEPVKSRTSNVNSNLSQPQQQENDVIGNDTKQDIENLTIGGGNNNDIVGNDNDKRNNITEIFDIRLSEGLNHLMFRCEDKISHETEFMNFWINVLP

Entity 12 Entity 12 polymer

Description description	Chromatin structure-remodeling complex subunit RSC2
Molecular weight formula_weight	102443.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MMPDDNSNSSTQNSSALYKDLRKEYESLFTLKEDSGLEISPIFNVLPPKKDYPDYYAVIKNPVSFNTLKKRIPHYTDAQQFMNDVVQIPWNAKTYNTRDSGIYKYALVLEKYLKDTIYPNLKEKYPQLVYPDLGPLPDEPGYEEFQQKLREKAEEVARANAARAESSSSMNSTEAARRLRKTRTSVKRESEPGTDTNNDEDYEATDMDIDNPKDADFPDLIRKPLININPYTRKPLRDNRSTTPSHSGTPQPLGPRHRQVSRTQVKRGRPPIIDLPYIQRMKNVMKVLKKEVLDSGIGLTDLFERLPDRHRDANYYIMIANPISLQDINKKVKTRRYKTFQEFQNDFNLMLTNFRISHRGDPESIKISNILEKTFTSLARFELSKPDRSFIPEGELRYPLDEVIVNNISYHVGDWALLRNQNDPQKPIVGQIFRLWKTPDGKQWLNACWYYRPEQTVHRVDRLFYKNEVMKTGQYRDHLVSNLVGKCYVIHFTRYQRGNPDMKLEGPLFVCEFRYNESDKIFNKIRTWKACLPEEIRDLDEATIPVNGRKFFKYPSPIRHLLPANATPHDRVPEPTMGSPDAPPLVGAVYMRPKMQRDDLGEYATSDDCPRYIIRPNDSPEEGQVDIETGTITTNTPTANALPKTGYSSSKLSSLRYNRSSMSLENQNAIGQQQIPLSRVGSPGAGGPLTVQGLKQHQLQRLQQQQHQYQQQKRSQASRYNIPTIIDDLTSQASRGNLGNIMIDAASSFVLPISITKNVDVLQRTDLHSQTKRSGREEMFPWKKTKGEILWFRGPSVIVNERIINSGDPHLSLPLNRWFTTNKKRKLEYEEVEETMEDVTGKDKDDDGLEPDVENEKESLPGPFVLGLRPSAKFTAHRLSMLRPPSSSS

Entity 13 Entity 13 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	280000

RSC substrate-recruitment module

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromatin structure-remodeling complex subunit RSC7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit RSC9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit SFH1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC58

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Nuclear protein STH1/NPS1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

High temperature lethal protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC30

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer