6kmv

caspase-11 C254A P22/P10 in complex with mouse GSDMD-C domain

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Caspase-4

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 3	Gasdermin-D × 1 （Q9D8T2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CASP4_MOUSE
Isoform	—
PDB entities	1, 2, 5, 7, 8, 10, 11, 14, 15
Chains and sequence ranges	Author chain A； PDBConstruct 1–161； UniProt 118–278 Author chain B； PDBConstruct 1–167； UniProt 101–267 Author chain V； PDBConstruct 1–167； UniProt 101–267 Author chain E； PDBConstruct 1–166； UniProt 101–266 Author chain F； PDBConstruct 1–166； UniProt 101–266 Author chain Z； PDBConstruct 1–166； UniProt 101–266 Author chain d； PDBConstruct 1–166； UniProt 101–266 Author chain I； PDBConstruct 1–165； UniProt 102–266 Author chain M； PDBConstruct 1–165； UniProt 102–266 Author chain N； PDBConstruct 1–165； UniProt 102–266 Author chain Q； PDBConstruct 1–165； UniProt 102–266 Author chain Y； PDBConstruct 1–165； UniProt 102–266 Author chain J； PDBConstruct 1–149； UniProt 118–266 Author chain R； PDBConstruct 1–150； UniProt 118–267 Author chain c； PDBConstruct 1–150； UniProt 118–267 Author chain U； PDBConstruct 1–165； UniProt 101–265 Author chain g； PDBConstruct 1–88； UniProt 286–373 Author chain h； PDBConstruct 1–88； UniProt 286–373 Author chain i； PDBConstruct 1–88； UniProt 286–373 Author chain j； PDBConstruct 1–88； UniProt 286–373 Author chain k； PDBConstruct 1–88； UniProt 286–373 Author chain l； PDBConstruct 1–88； UniProt 286–373 Author chain m； PDBConstruct 1–88； UniProt 286–373 Author chain n； PDBConstruct 1–88； UniProt 286–373 Author chain o； PDBConstruct 1–88； UniProt 286–373 Author chain p； PDBConstruct 1–88； UniProt 286–373 Author chain q； PDBConstruct 1–88； UniProt 286–373 Author chain r； PDBConstruct 1–88； UniProt 286–373 Author chain t； PDBConstruct 1–88； UniProt 286–373 Author chain u； PDBConstruct 1–88； UniProt 286–373 Author chain v； PDBConstruct 1–88； UniProt 286–373 Author chain s； PDBConstruct 1–87； UniProt 287–373

Gasdermin-D

Mus musculus

UniProt Q9D8T2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
11	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
12	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
13	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
14	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
15	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
16	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count
9	Protein heterocomplex	Heteromer	Protein 3	Caspase-4 × 1 （P70343） Caspase-4 × 1 （P70343）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GSDMD_MOUSE
Isoform	—
PDB entities	3, 4, 6, 9, 12, 13
Chains and sequence ranges	Author chain C； PDBConstruct 1–198； UniProt 287–484 Author chain G； PDBConstruct 1–198； UniProt 287–484 Author chain O； PDBConstruct 1–198； UniProt 287–484 Author chain D； PDBConstruct 1–197； UniProt 288–484 Author chain K； PDBConstruct 1–197； UniProt 288–484 Author chain S； PDBConstruct 1–197； UniProt 288–484 Author chain T； PDBConstruct 1–197； UniProt 288–484 Author chain W； PDBConstruct 1–197； UniProt 288–484 Author chain b； PDBConstruct 1–197； UniProt 288–484 Author chain f； PDBConstruct 1–197； UniProt 288–484 Author chain H； PDBConstruct 1–191； UniProt 294–484 Author chain L； PDBConstruct 1–214； UniProt 271–484 Author chain P； PDBConstruct 1–214； UniProt 271–484 Author chain e； PDBConstruct 1–214； UniProt 271–484 Author chain X； PDBConstruct 1–199； UniProt 286–484 Author chain a； PDBConstruct 1–196； UniProt 289–484

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6kmv
Deposition date deposition_date	2019-08-01
Structure title title	caspase-11 C254A P22/P10 in complex with mouse GSDMD-C domain
Keywords keywords	pyroptosis, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6kmv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6kmv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6kmv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.49 Å
Rg (electron density)	30.04 Å
Total Rg	30.57 Å
Atom count	3490
Residues	447
Excluded volume	62445 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6kmv__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6kmv__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6kmv__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6kmv__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`6kmv__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`6kmv__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`6kmv__assembly_7__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`6kmv__assembly_8__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`6kmv__assembly_9__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`6kmv__assembly_10__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`6kmv__assembly_11__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`6kmv__assembly_12__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
13	1	`6kmv__assembly_13__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
14	1	`6kmv__assembly_14__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
15	1	`6kmv__assembly_15__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
16	1	`6kmv__assembly_16__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	Caspase-4
Molecular weight formula_weight	18030.6 kDa
EC 编号 ec_number	3.4.22.64
Mutation mutation	C254A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	56064

TQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQAARGGNSGEMWIRESSKPQLCRGVDL

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Caspase-4
Molecular weight formula_weight	18870.6 kDa
EC 编号 ec_number	3.4.22.64
Mutation mutation	C254A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,V

TLKLCSPEEFTRLCREKTQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQAARGGNSGEMWIRES

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Gasdermin-D
Molecular weight formula_weight	21497.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G,O

ADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQ

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Gasdermin-D
Molecular weight formula_weight	21426.4 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,K,S,T,W,b,f

DFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQ

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 5 Entity 5 polymer

Description description	Caspase-4
Molecular weight formula_weight	18783.5 kDa
EC 编号 ec_number	3.4.22.64
Mutation mutation	C254A
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,Z,d

TLKLCSPEEFTRLCREKTQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQAARGGNSGEMWIRE

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 6 Entity 6 polymer

Description description	Gasdermin-D
Molecular weight formula_weight	20702.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

AEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQ

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 7 Entity 7 polymer

Description description	Caspase-4
Molecular weight formula_weight	18682.4 kDa
EC 编号 ec_number	3.4.22.64
Mutation mutation	C254A
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,M,N,Q,Y

LKLCSPEEFTRLCREKTQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQAARGGNSGEMWIRE

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 8 Entity 8 polymer

Description description	Caspase-4
Molecular weight formula_weight	16744.1 kDa
EC 编号 ec_number	3.4.22.64
Mutation mutation	C254A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

TQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQAARGGNSGEMWIRE

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 9 Entity 9 polymer

Description description	Gasdermin-D
Molecular weight formula_weight	23225.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,P,e

LSLLSDGIDEEELIEAADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQ

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 10 Entity 10 polymer

Description description	Caspase-4
Molecular weight formula_weight	16831.2 kDa
EC 编号 ec_number	3.4.22.64
Mutation mutation	C254A
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,c

TQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQAARGGNSGEMWIRES

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 11 Entity 11 polymer

Description description	Caspase-4
Molecular weight formula_weight	18654.4 kDa
EC 编号 ec_number	3.4.22.64
Mutation mutation	C254A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

TLKLCSPEEFTRLCREKTQEIYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGMESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCPGLRDKPKVIIVQAARGGNSGEMWIR

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 12 Entity 12 polymer

Description description	Gasdermin-D
Molecular weight formula_weight	21568.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

AADFQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQ

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 13 Entity 13 polymer

Description description	Gasdermin-D
Molecular weight formula_weight	21311.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

FQGLYAEVKACSSELESLEMELRQQILVNIGKILQDQPSMEALEASLGQGLCSGGQVEPLDGPAGCILECLVLDSGELVPELAAPIFYLLGALAVLSETQQQLLAKALETTVLSKQLELVKHVLEQSTPWQEQSSVSLPTVLLGDCWDEKNPTWVLLEECGLRLQVESPQVHWEPTSLIPTSALYASLFLLSSLGQ

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 14 Entity 14 polymer

Description description	Caspase-4
Molecular weight formula_weight	10283.8 kDa
EC 编号 ec_number	3.4.22.64
Source method src_method	man
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,h,i,j,k,l,m,n,o,p,q,r,t,u,v

AVKLSHVEKDFIAFYSTTPHHLSYRDKTGGSYFITRLISCFRKHACSCHLFDIFLKVQQSFEKASIHSQMPTIDRATLTRYFYLFPGN

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 15 Entity 15 polymer

Description description	Caspase-4
Molecular weight formula_weight	10212.8 kDa
EC 编号 ec_number	3.4.22.64
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

VKLSHVEKDFIAFYSTTPHHLSYRDKTGGSYFITRLISCFRKHACSCHLFDIFLKVQQSFEKASIHSQMPTIDRATLTRYFYLFPGN

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

▼

6. Fold Classification (SCOP + CATH) 31 domains

CATH v4.4 (31 domains)

Domain ID domain_id	6kmvA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvF01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvI01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvJ01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvM01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvQ01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvR01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvU01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvV01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvY01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvZ01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvc01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvd01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	1460 —

Domain ID domain_id	6kmvg00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvh00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvi00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvj00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvk00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvl00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvm00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvn00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvo00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvp00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvq00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvr00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvs00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvt00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvu00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

Domain ID domain_id	6kmvv00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	1470 — Caspase-like

▶

Unit-cell length a length_a	89.798 Å
Unit-cell length b length_b	139.207 Å
Unit-cell length c length_c	175.942 Å
Unit-cell angle α angle_alpha	92.43 °
Unit-cell angle β angle_beta	99.06 °
Unit-cell angle γ angle_gamma	96.35 °
Molecules per unit cell Z z_pdb	15

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.350 Å
Low-resolution limit resolution_low	37.442 Å
R factor r_factor	0.2194
R_work r_work	0.2188
R_free r_free	0.2520

caspase-11 C254A P22/P10 in complex with mouse GSDMD-C domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Caspase-4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Gasdermin-D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6kmv__assembly_1__model_1

6kmv__assembly_1__model_1 | I(q)

6kmv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 polymer

Polymer Polymer

Source Source

Entity 8 Entity 8 polymer

Polymer Polymer

Source Source

Entity 9 Entity 9 polymer

Polymer Polymer

Source Source

Entity 10 Entity 10 polymer

Polymer Polymer

Source Source

Entity 11 Entity 11 polymer

Polymer Polymer

Source Source

Entity 12 Entity 12 polymer

Polymer Polymer

Source Source

Entity 13 Entity 13 polymer

Polymer Polymer

Source Source

Entity 14 Entity 14 polymer

Polymer Polymer

Source Source

Entity 15 Entity 15 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 31 domains

CATH v4.4 (31 domains)

7. Citations (1)