6m32

Cryo-EM structure of FMO-RC complex from green sulfur bacteria

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bacteriochlorophyll a protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	P840 reaction center 17 kDa protein × 1 （Q8KEP5） Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） BACTERIOCHLOROPHYLL A × 48 IRON/SULFUR CLUSTER × 3 Bacteriochlorophyll A isomer × 2 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 2 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CALCIUM ION × 2 Chlorophyll A ester × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCPA_CHLTE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 1–366； UniProt 1–366 Author chain F； PDBConstruct 1–366； UniProt 1–366 Author chain G； PDBConstruct 1–366； UniProt 1–366

P840 reaction center 17 kDa protein

OrganismNot specified

UniProt Q8KEP5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Bacteriochlorophyll a protein × 3 （Q46393） Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） BACTERIOCHLOROPHYLL A × 48 IRON/SULFUR CLUSTER × 3 Bacteriochlorophyll A isomer × 2 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 2 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CALCIUM ION × 2 Chlorophyll A ester × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSCD_CHLTE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–143； UniProt 1–143

Photosystem P840 reaction center iron-sulfur protein

OrganismNot specified

UniProt Q8KAY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Bacteriochlorophyll a protein × 3 （Q46393） P840 reaction center 17 kDa protein × 1 （Q8KEP5） Photosystem P840 reaction center, large subunit × 2 （Q8KAY0） BACTERIOCHLOROPHYLL A × 48 IRON/SULFUR CLUSTER × 3 Bacteriochlorophyll A isomer × 2 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 2 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CALCIUM ION × 2 Chlorophyll A ester × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8KAY1_CHLTE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–231； UniProt 1–231

Photosystem P840 reaction center, large subunit

OrganismNot specified

UniProt Q8KAY0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Bacteriochlorophyll a protein × 3 （Q46393） P840 reaction center 17 kDa protein × 1 （Q8KEP5） Photosystem P840 reaction center iron-sulfur protein × 1 （Q8KAY1） BACTERIOCHLOROPHYLL A × 48 IRON/SULFUR CLUSTER × 3 Bacteriochlorophyll A isomer × 2 ;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ; × 2 ;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ; × 2 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 2 CALCIUM ION × 2 Chlorophyll A ester × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8KAY0_CHLTE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–731； UniProt 1–731 Author chain a； PDBConstruct 1–731； UniProt 1–731

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6m32
Deposition date deposition_date	2020-03-02
Structure title title	Cryo-EM structure of FMO-RC complex from green sulfur bacteria
Keywords keywords	Photosynthetic reaction center, Green sulfur bacteria, Energy transfer, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6m32__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6m32__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6m32__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	50.76 Å
Rg (electron density)	50.76 Å
Total Rg	50.70 Å
Atom count	23428
Residues	2523
Excluded volume	428460 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6m32__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Bacteriochlorophyll a protein
Molecular weight formula_weight	40343.4 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G
Atom count atom_count	23566

MALFGSNDVTTAHSDYEIVLEGGSSSWGKVKARAKVNAPPASPLLPADCDVKLNVKPLDPAKGFVRISAVFESIVDSTKNKLTIEADIANETKERRISVGEGMVSVGDFSHTFSFEGSVVNLFYYRSDAVRRNVPNPIYMQGRQFHDILMKVPLDNNDLIDTWEGTVKAIGSTGAFNDWIRDFWFIGPAFTALNEGGQRISRIEVNGLNTESGPKGPVGVSRWRFSHGGSGMVDSISRWAELFPSDKLNRPAQVEAGFRSDSQGIEVKVDGEFPGVSVDAGGGLRRILNHPLIPLVHHGMVGKFNNFNVDAQLKVVLPKGYKIRYAAPQYRSQNLEEYRWSGGAYARWVEHVCKGGVGQFEILYAQ

Entity 2 Entity 2 polymer

Description description	P840 reaction center 17 kDa protein
Molecular weight formula_weight	16633.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MQPQLSRPQTASNQVRKAVSGPWSGNAVHKAEKYFITSAKRDRDGKLQIELVPASGRRKLSPTPEMIRRLIDGEIEIYILTTQPDIAIDMNKEIIDMENRYVIDFDKRGVKWTMREIPVFYHEGKGLCVELHNKIYTLDQFFK

Entity 3 Entity 3 polymer

Description description	Photosystem P840 reaction center iron-sulfur protein
Molecular weight formula_weight	23540.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAEPVENKNQAPAPGAKVPPKGAPAAPKAGAPAAPKGPVAPKAGAPAAKTGASAAKQAGKPRLASLGVTLGRSGVRQESALPYVKPKAVPPPKPAAPAAKGAPAPKGAPAAPAAKAAPGAPVAKAAPKAKKHYFIIENLCVGCGLCLDKCPPKVNAIGYKFYGDVQEGGFRCYIDQAACISCSACFSGDECPSGALIEVLPDGEVLDFSYTPPERLDFDLRFLHRFHREAR

Entity 4 Entity 4 polymer

Description description	Photosystem P840 reaction center, large subunit
Molecular weight formula_weight	81784.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a

MAEQVKPAGVKPKGTVPPPKGNAPAPKANGAPGGASVIKEQDAAKMRRFLFQRTETRSTKWYQIFDTEKLDDEQVVGGHLALLGVLGFIMGIYYISGIQVFPWGAPGFHDNWFYLTIKPRMVSLGIDTYSTKTADLEAAGARLLGWAAFHFLVGSVLIFGGWRHWTHNLTNPFTGRCGNFRDFRFLGKFGDVVFNGTSAKSYKEALGPHAVYMSLLFLGWGIVMWAILGFAPIPDFQTINSETFMSFVFAVIFFALGIYWWNNPPNAAIHLNDDMKAAFSVHLTAIGYINIALGCIAFVAFQQPSFAPYYKELDKLVFYLYGEPFNRVSFNFVEQGGKVISGAKEFADFPAYAILPKSGEAFGMARVVTNLIVFNHIICGVLYVFAGVYHGGQYLLKIQLNGMYNQIKSIWITKGRDQEVQVKILGTVMALCFATMLSVYAVIVWNTICELNIFGTNITMSFYWLKPLPIFQWMFADPSINDWVMAHVITAGSLFSLIALVRIAFFAHTSPLWDDLGLKKNSYSFPCLGPVYGGTCGVSIQDQLWFAMLWGIKGLSAVCWYIDGAWIASMMYGVPAADAKAWDSIAHLHHHYTSGIFYYFWTETVTIFSSSHLSTILMIGHLVWFISFAVWFEDRGSRLEGADIQTRTIRWLGKKFLNRDVNFRFPVLTISDSKLAGTFLYFGGTFMLVFLFLANGFYQTNSPLPPPVSHAAVSGQQMLAQLVDTLMKMIA

Entity 5 Entity 5 non-polymer

Description description	BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	48

Entity 6 Entity 6 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 7 Entity 7 non-polymer

Description description	Bacteriochlorophyll A isomer
Molecular weight formula_weight	911.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 non-polymer

Description description	;2-[(1E,3E,5E,7E,9E,11E,13E,15E,17E,19E)-3,7,12,16,20,24-hexamethylpentacosa-1,3,5,7,9,11,13,15,17,19,23-undecaenyl]-1,3,4-trimethyl-benzene ;
Molecular weight formula_weight	532.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 9 Entity 9 non-polymer

Description description	;[(2R,3S,4S,5R,6R)-6-[(10E,12E,14E)-2,6,10,14,19,23-hexamethyl-25-(2,3,6-trimethylphenyl)pentacosa-6,8,10,12,14,16,18,20,22,24-decaen-2-yl]oxy-3,4,5-tris(oxidanyl)oxan-2-yl]methyl dodecanoate ;
Molecular weight formula_weight	895.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 13 Entity 13 non-polymer

Description description	Chlorophyll A ester
Molecular weight formula_weight	891.5 kDa
Source method src_method	syn
Copy count entity_count	4

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d6m32e_
Class class	b — All beta proteins
Fold Fold fold	b.75 — Bacteriochlorophyll A protein
Superfamily Superfamily superfamily	b.75.1 — Bacteriochlorophyll A protein
Family Family family	b.75.1.1 — Bacteriochlorophyll A protein

Domain ID domain_id	d6m32f_
Class class	b — All beta proteins
Fold Fold fold	b.75 — Bacteriochlorophyll A protein
Superfamily Superfamily superfamily	b.75.1 — Bacteriochlorophyll A protein
Family Family family	b.75.1.1 — Bacteriochlorophyll A protein

Domain ID domain_id	d6m32g_
Class class	b — All beta proteins
Fold Fold fold	b.75 — Bacteriochlorophyll A protein
Superfamily Superfamily superfamily	b.75.1 — Bacteriochlorophyll A protein
Family Family family	b.75.1.1 — Bacteriochlorophyll A protein

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	268430

Cryo-EM structure of FMO-RC complex from green sulfur bacteria

1. Protein Identity and Related Structures Protein Identity & Related Structures

Bacteriochlorophyll a protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

P840 reaction center 17 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem P840 reaction center iron-sulfur protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem P840 reaction center, large subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6m32__assembly_1__model_1

6m32__assembly_1__model_1 | I(q)

6m32__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 non-polymer

Entity 13 Entity 13 non-polymer

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

7. Citations (1)