6nmf

SFX structure of reduced cytochrome c oxidase at room temperature

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–514； UniProt 1–514 Author chain N； PDBConstruct 1–514； UniProt 1–514

Cytochrome c oxidase subunit 2

OrganismNot specified

UniProt P68530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–227； UniProt 1–227 Author chain O； PDBConstruct 1–227； UniProt 1–227

Cytochrome c oxidase subunit 3

OrganismNot specified

UniProt P00415

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–261； UniProt 1–261 Author chain P； PDBConstruct 1–261； UniProt 1–261

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

OrganismNot specified

UniProt P00423

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX41_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–147； UniProt 23–169 Author chain Q； PDBConstruct 1–147； UniProt 23–169

Cytochrome c oxidase subunit 5A, mitochondrial

OrganismNot specified

UniProt P00426

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_BOVIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–109； UniProt 44–152 Author chain R； PDBConstruct 1–109； UniProt 44–152

Cytochrome c oxidase subunit 5B, mitochondrial

OrganismNot specified

UniProt P00428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5B_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–98； UniProt 32–129 Author chain S； PDBConstruct 1–98； UniProt 32–129

Cytochrome c oxidase subunit 6A2, mitochondrial

OrganismNot specified

UniProt P07471

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6A2_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–85； UniProt 13–97 Author chain T； PDBConstruct 1–85； UniProt 13–97

Cytochrome c oxidase subunit 6B1

OrganismNot specified

UniProt P00429

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6B1_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–85； UniProt 2–86 Author chain U； PDBConstruct 1–85； UniProt 2–86

Cytochrome c oxidase subunit 6C

OrganismNot specified

UniProt P04038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6C_BOVIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–73； UniProt 2–74 Author chain V； PDBConstruct 1–73； UniProt 2–74

Cytochrome c oxidase subunit 7A1, mitochondrial

OrganismNot specified

UniProt P07470

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX7A1_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–59； UniProt 22–80 Author chain W； PDBConstruct 1–59； UniProt 22–80

Cytochrome c oxidase subunit 7B, mitochondrial

OrganismNot specified

UniProt P13183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7B_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–56； UniProt 25–80 Author chain X； PDBConstruct 1–56； UniProt 25–80

Cytochrome c oxidase subunit 7C, mitochondrial

OrganismNot specified

UniProt P00430

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 8B, mitochondrial × 2 （P10175） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7C_BOVIN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–47； UniProt 17–63 Author chain Y； PDBConstruct 1–47； UniProt 17–63

Cytochrome c oxidase subunit 8B, mitochondrial

OrganismNot specified

UniProt P10175

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Cytochrome c oxidase subunit 1 × 2 （P00396） Cytochrome c oxidase subunit 2 × 2 （P68530） Cytochrome c oxidase subunit 3 × 2 （P00415） Cytochrome c oxidase subunit 4 isoform 1, mitochondrial × 2 （P00423） Cytochrome c oxidase subunit 5A, mitochondrial × 2 （P00426） Cytochrome c oxidase subunit 5B, mitochondrial × 2 （P00428） Cytochrome c oxidase subunit 6A2, mitochondrial × 2 （P07471） Cytochrome c oxidase subunit 6B1 × 2 （P00429） Cytochrome c oxidase subunit 6C × 2 （P04038） Cytochrome c oxidase subunit 7A1, mitochondrial × 2 （P07470） Cytochrome c oxidase subunit 7B, mitochondrial × 2 （P13183） Cytochrome c oxidase subunit 7C, mitochondrial × 2 （P00430） HEME-A × 4 COPPER (II) ION × 2 MAGNESIUM ION × 2 SODIUM ION × 2 (1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE × 8 TRISTEAROYLGLYCEROL × 6 CARDIOLIPIN × 4 DINUCLEAR COPPER ION × 2 CHOLIC ACID × 8 (7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE × 2 DECYL-BETA-D-MALTOPYRANOSIDE × 4 (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE × 6 ZINC ION × 2 water × 26	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX8B_BOVIN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–46； UniProt 25–70 Author chain Z； PDBConstruct 1–46； UniProt 25–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6nmf
Deposition date deposition_date	2019-01-10
Structure title title	SFX structure of reduced cytochrome c oxidase at room temperature
Keywords keywords	complex IV, membrane protein, Terminal enzyme, electron transfer, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6nmf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6nmf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6nmf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.07 Å
Rg (electron density)	50.21 Å
Total Rg	50.45 Å
Atom count	30730
Residues	3550
Excluded volume	563500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6nmf__assembly_1__model_1`	26-meric （26）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (27)

Entity 1 Entity 1 polymer

Description description	Cytochrome c oxidase subunit 1
Molecular weight formula_weight	57093.9 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N
Atom count atom_count	32083

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK

Entity 2 Entity 2 polymer

Description description	Cytochrome c oxidase subunit 2
Molecular weight formula_weight	26068.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,O

MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML

Entity 3 Entity 3 polymer

Description description	Cytochrome c oxidase subunit 3
Molecular weight formula_weight	29957.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS

Entity 4 Entity 4 polymer

Description description	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
Molecular weight formula_weight	17179.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,Q

AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK

Entity 5 Entity 5 polymer

Description description	Cytochrome c oxidase subunit 5A, mitochondrial
Molecular weight formula_weight	12453.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R

SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Entity 6 Entity 6 polymer

Description description	Cytochrome c oxidase subunit 5B, mitochondrial
Molecular weight formula_weight	10684.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S

ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase subunit 6A2, mitochondrial
Molecular weight formula_weight	9629.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T

ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEKP

Entity 8 Entity 8 polymer

Description description	Cytochrome c oxidase subunit 6B1
Molecular weight formula_weight	10039.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,U

AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI

Entity 9 Entity 9 polymer

Description description	Cytochrome c oxidase subunit 6C
Molecular weight formula_weight	8537.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,V

STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK

Entity 10 Entity 10 polymer

Description description	Cytochrome c oxidase subunit 7A1, mitochondrial
Molecular weight formula_weight	6682.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,W

FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK

Entity 11 Entity 11 polymer

Description description	Cytochrome c oxidase subunit 7B, mitochondrial
Molecular weight formula_weight	6365.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,X

IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ

Entity 12 Entity 12 polymer

Description description	Cytochrome c oxidase subunit 7C, mitochondrial
Molecular weight formula_weight	5449.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Y

SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK

Entity 13 Entity 13 polymer

Description description	Cytochrome c oxidase subunit 8B, mitochondrial
Molecular weight formula_weight	4967.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,Z

ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA

Entity 14 Entity 14 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	man
Copy count entity_count	4

Entity 15 Entity 15 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 17 Entity 17 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 18 Entity 18 non-polymer

Description description	(1R)-2-{[{[(2S)-2,3-DIHYDROXYPROPYL]OXY}(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL (11E)-OCTADEC-11-ENOATE
Molecular weight formula_weight	749.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 19 Entity 19 non-polymer

Description description	TRISTEAROYLGLYCEROL
Molecular weight formula_weight	891.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 20 Entity 20 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	man
Copy count entity_count	4

Entity 21 Entity 21 non-polymer

Description description	DINUCLEAR COPPER ION
Molecular weight formula_weight	127.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 22 Entity 22 non-polymer

Description description	CHOLIC ACID
Molecular weight formula_weight	408.6 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 23 Entity 23 non-polymer

Description description	(7R,17E,20E)-4-HYDROXY-N,N,N-TRIMETHYL-9-OXO-7-[(PALMITOYLOXY)METHYL]-3,5,8-TRIOXA-4-PHOSPHAHEXACOSA-17,20-DIEN-1-AMINIUM 4-OXIDE
Molecular weight formula_weight	759.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 24 Entity 24 non-polymer

Description description	DECYL-BETA-D-MALTOPYRANOSIDE
Molecular weight formula_weight	482.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 25 Entity 25 non-polymer

Description description	(1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(STEAROYLOXY)METHYL]ETHYL (5E,8E,11E,14E)-ICOSA-5,8,11,14-TETRAENOATE
Molecular weight formula_weight	768.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 26 Entity 26 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	744

▼

6. Fold Classification (SCOP + CATH) 54 domains

SCOP 2.08 (28 domains)

Domain ID domain_id	d6nmfa_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.24 — Cytochrome c oxidase subunit I-like
Superfamily Superfamily superfamily	f.24.1 — Cytochrome c oxidase subunit I-like
Family Family family	f.24.1.1 — Cytochrome c oxidase subunit I-like

Domain ID domain_id	d6nmfb1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.2 — Cytochrome c oxidase subunit II-like, transmembrane region
Family Family family	f.17.2.1 — Cytochrome c oxidase subunit II-like, transmembrane region

Domain ID domain_id	d6nmfb2
Class class	b — All beta proteins
Fold Fold fold	b.6 — Cupredoxin-like
Superfamily Superfamily superfamily	b.6.1 — Cupredoxins
Family Family family	b.6.1.2 — Periplasmic domain of cytochrome c oxidase subunit II

Domain ID domain_id	d6nmfc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.25 — Cytochrome c oxidase subunit III-like
Superfamily Superfamily superfamily	f.25.1 — Cytochrome c oxidase subunit III-like
Family Family family	f.25.1.1 — Cytochrome c oxidase subunit III-like

Domain ID domain_id	d6nmfd_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.1 — Mitochondrial cytochrome c oxidase subunit IV
Family Family family	f.23.1.1 — Mitochondrial cytochrome c oxidase subunit IV

Domain ID domain_id	d6nmfe_
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.11 — Cytochrome c oxidase subunit E
Family Family family	a.118.11.1 — Cytochrome c oxidase subunit E

Domain ID domain_id	d6nmff_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.5 — Rubredoxin-like
Family Family family	g.41.5.3 — Cytochrome c oxidase Subunit F

Domain ID domain_id	d6nmfg_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.2 — Mitochondrial cytochrome c oxidase subunit VIa
Family Family family	f.23.2.1 — Mitochondrial cytochrome c oxidase subunit VIa

Domain ID domain_id	d6nmfh_
Class class	a — All alpha proteins
Fold Fold fold	a.51 — Cytochrome c oxidase subunit h
Superfamily Superfamily superfamily	a.51.1 — Cytochrome c oxidase subunit h
Family Family family	a.51.1.1 — Cytochrome c oxidase subunit h

Domain ID domain_id	d6nmfi_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.3 — Mitochondrial cytochrome c oxidase subunit VIc
Family Family family	f.23.3.1 — Mitochondrial cytochrome c oxidase subunit VIc

Domain ID domain_id	d6nmfj_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.4 — Mitochondrial cytochrome c oxidase subunit VIIa
Family Family family	f.23.4.1 — Mitochondrial cytochrome c oxidase subunit VIIa

Domain ID domain_id	d6nmfk_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.5 — Mitochondrial cytochrome c oxidase subunit VIIb
Family Family family	f.23.5.1 — Mitochondrial cytochrome c oxidase subunit VIIb

Domain ID domain_id	d6nmfl_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.6 — Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)
Family Family family	f.23.6.1 — Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)

Domain ID domain_id	d6nmfm_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.7 — Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)
Family Family family	f.23.7.1 — Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)

Domain ID domain_id	d6nmfn_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.24 — Cytochrome c oxidase subunit I-like
Superfamily Superfamily superfamily	f.24.1 — Cytochrome c oxidase subunit I-like
Family Family family	f.24.1.1 — Cytochrome c oxidase subunit I-like

Domain ID domain_id	d6nmfo1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.2 — Cytochrome c oxidase subunit II-like, transmembrane region
Family Family family	f.17.2.1 — Cytochrome c oxidase subunit II-like, transmembrane region

Domain ID domain_id	d6nmfo2
Class class	b — All beta proteins
Fold Fold fold	b.6 — Cupredoxin-like
Superfamily Superfamily superfamily	b.6.1 — Cupredoxins
Family Family family	b.6.1.2 — Periplasmic domain of cytochrome c oxidase subunit II

Domain ID domain_id	d6nmfp_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.25 — Cytochrome c oxidase subunit III-like
Superfamily Superfamily superfamily	f.25.1 — Cytochrome c oxidase subunit III-like
Family Family family	f.25.1.1 — Cytochrome c oxidase subunit III-like

Domain ID domain_id	d6nmfq_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.1 — Mitochondrial cytochrome c oxidase subunit IV
Family Family family	f.23.1.1 — Mitochondrial cytochrome c oxidase subunit IV

Domain ID domain_id	d6nmfr_
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.11 — Cytochrome c oxidase subunit E
Family Family family	a.118.11.1 — Cytochrome c oxidase subunit E

Domain ID domain_id	d6nmfs_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.5 — Rubredoxin-like
Family Family family	g.41.5.3 — Cytochrome c oxidase Subunit F

Domain ID domain_id	d6nmft_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.2 — Mitochondrial cytochrome c oxidase subunit VIa
Family Family family	f.23.2.1 — Mitochondrial cytochrome c oxidase subunit VIa

Domain ID domain_id	d6nmfu_
Class class	a — All alpha proteins
Fold Fold fold	a.51 — Cytochrome c oxidase subunit h
Superfamily Superfamily superfamily	a.51.1 — Cytochrome c oxidase subunit h
Family Family family	a.51.1.1 — Cytochrome c oxidase subunit h

Domain ID domain_id	d6nmfv_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.3 — Mitochondrial cytochrome c oxidase subunit VIc
Family Family family	f.23.3.1 — Mitochondrial cytochrome c oxidase subunit VIc

Domain ID domain_id	d6nmfw_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.4 — Mitochondrial cytochrome c oxidase subunit VIIa
Family Family family	f.23.4.1 — Mitochondrial cytochrome c oxidase subunit VIIa

Domain ID domain_id	d6nmfx_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.5 — Mitochondrial cytochrome c oxidase subunit VIIb
Family Family family	f.23.5.1 — Mitochondrial cytochrome c oxidase subunit VIIb

Domain ID domain_id	d6nmfy_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.6 — Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)
Family Family family	f.23.6.1 — Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)

Domain ID domain_id	d6nmfz_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.7 — Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)
Family Family family	f.23.7.1 — Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)

CATH v4.4 (26 domains)

Domain ID domain_id	6nmfB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	6nmfB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

Domain ID domain_id	6nmfC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6nmfC02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	6nmfD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	442 — Cytochrome C Oxidase; Chain D
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit IV

Domain ID domain_id	6nmfE00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	40 — Cytochrome c oxidase, subunit Va/VI

Domain ID domain_id	6nmfG00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	95 — Cytochrome C Oxidase; Chain G
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit VIa

Domain ID domain_id	6nmfH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	140 — Cytochrome c oxidase, subunit VIb

Domain ID domain_id	6nmfI00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	93 — Cytochrome C Oxidase; Chain I
Homologous superfamily homologous superfamily	10 — Mitochondrial cytochrome c oxidase subunit VIc/VIIs

Domain ID domain_id	6nmfJ00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	91 — Cytochrome C Oxidase; Chain J
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit VIIa

Domain ID domain_id	6nmfK00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	51 — Cytochrome C Oxidase; Chain K
Homologous superfamily homologous superfamily	10 — Cytochrome C Oxidase, chain K

Domain ID domain_id	6nmfL00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	49 — Cytochrome C Oxidase; Chain L
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit VIIc

Domain ID domain_id	6nmfM00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	81 — Cytochrome C Oxidase; Chain M
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit 8

Domain ID domain_id	6nmfO01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	6nmfO02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

Domain ID domain_id	6nmfP01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	6nmfP02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	6nmfQ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	442 — Cytochrome C Oxidase; Chain D
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit IV

Domain ID domain_id	6nmfR00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	40 — Cytochrome c oxidase, subunit Va/VI

Domain ID domain_id	6nmfT00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	95 — Cytochrome C Oxidase; Chain G
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit VIa

Domain ID domain_id	6nmfU00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	140 — Cytochrome c oxidase, subunit VIb

Domain ID domain_id	6nmfV00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	93 — Cytochrome C Oxidase; Chain I
Homologous superfamily homologous superfamily	10 — Mitochondrial cytochrome c oxidase subunit VIc/VIIs

Domain ID domain_id	6nmfW00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	91 — Cytochrome C Oxidase; Chain J
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit VIIa

Domain ID domain_id	6nmfX00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	51 — Cytochrome C Oxidase; Chain K
Homologous superfamily homologous superfamily	10 — Cytochrome C Oxidase, chain K

Domain ID domain_id	6nmfY00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	49 — Cytochrome C Oxidase; Chain L
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit VIIc

Domain ID domain_id	6nmfZ00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	81 — Cytochrome C Oxidase; Chain M
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit 8

▶

Unit-cell length a length_a	178.700 Å
Unit-cell length b length_b	189.800 Å
Unit-cell length c length_c	211.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	0.1788
R_work r_work	0.1760
R_free r_free	0.2321

SFX structure of reduced cytochrome c oxidase at room temperature

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 4 isoform 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 5A, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 5B, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6A2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6B1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 6C

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase subunit 7A1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer