SAXSdb — 6o09

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proliferating cellular nuclear antigen 1

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Uncharacterized protein × 3 （K7MRE7） water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Uncharacterized protein × 3 （K7MRE7） water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PCNA1_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 50–312； UniProt 1–263 Author chain C； PDBConstruct 50–312； UniProt 1–263 Author chain D； PDBConstruct 50–312； UniProt 1–263 Author chain F； PDBConstruct 50–312； UniProt 1–263 Author chain H； PDBConstruct 50–312； UniProt 1–263 Author chain K； PDBConstruct 50–312； UniProt 1–263

Uncharacterized protein

OrganismNot specified

UniProt K7MRE7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Proliferating cellular nuclear antigen 1 × 3 （Q9M7Q7） water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Proliferating cellular nuclear antigen 1 × 3 （Q9M7Q7） water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	K7MRE7_SOYBN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–20； UniProt 78–96 Author chain E； PDBConstruct 2–20； UniProt 78–96 Author chain G； PDBConstruct 2–20； UniProt 78–96 Author chain I； PDBConstruct 2–20； UniProt 78–96 Author chain J； PDBConstruct 2–20； UniProt 78–96 Author chain L； PDBConstruct 2–20； UniProt 78–96

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6o09
Deposition date deposition_date	2019-02-15
Structure title title	Structure of AtPCNA in complex with the PIP motif of ATXR6
Keywords keywords	histone, methylation, nucleosome, PCNA, PIP, DNA replication, atxr5, atxr6, NUCLEAR PROTEIN; NUCLEAR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6o09__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6o09__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6o09__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.70 Å
Rg (electron density)	32.74 Å
Total Rg	33.35 Å
Atom count	5963
Residues	809
Excluded volume	107230 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6o09__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6o09__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Proliferating cellular nuclear antigen 1
Molecular weight formula_weight	34573.1 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,A,D,F,H,K
Atom count atom_count	12307

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMGHHHHHHENLYFQGMLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYKVAEMGYIRYYLAPKIEEEEDTNP

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	Mouse-ear cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Uncharacterized protein
Molecular weight formula_weight	2424.8 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,B,E,G,J,L

YPLVQTKIIDFFRIQRSPEA

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	402

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	6o09A00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6o09C00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6o09D00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6o09F00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6o09H00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	6o09K00
Class class	3 — Alpha Beta
Architecture architecture	70 — Box
Topology topology	10 — Proliferating Cell Nuclear Antigen
Homologous superfamily homologous superfamily	10 —

▶

Unit-cell length a length_a	72.902 Å
Unit-cell length b length_b	90.549 Å
Unit-cell length c length_c	90.510 Å
Unit-cell angle α angle_alpha	60.05 °
Unit-cell angle β angle_beta	73.46 °
Unit-cell angle γ angle_gamma	73.59 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.060 Å
Low-resolution limit resolution_low	29.652 Å
R factor r_factor	0.1972
R_work r_work	0.1965
R_free r_free	0.2343

Structure of AtPCNA in complex with the PIP motif of ATXR6

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proliferating cellular nuclear antigen 1

State in the Current Structure

Other States of the Same Protein in the Database

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6o09__assembly_1__model_1

6o09__assembly_1__model_1 | I(q)

6o09__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

Structure of AtPCNA in complex with the PIP motif of ATXR6

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proliferating cellular nuclear antigen 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6o09__assembly_1__model_1

6o09__assembly_1__model_1 | I(q)

6o09__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)