SAXSdb — 6qsz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Regulatory protein SIR4

Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

UniProt P11978

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Silent chromatin protein ESC1 × 1 （Q03661） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Silent chromatin protein ESC1 × 1 （Q03661） CHLORIDE ION × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Silent chromatin protein ESC1 × 1 （Q03661） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Silent chromatin protein ESC1 × 1 （Q03661） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Silent chromatin protein ESC1 × 1 （Q03661） water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Silent chromatin protein ESC1 × 1 （Q03661） water × 2	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 2	Silent chromatin protein ESC1 × 1 （Q03661） water × 2	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 2	Silent chromatin protein ESC1 × 1 （Q03661） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SIR4_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–127； UniProt 961–1085 Author chain C； PDBConstruct 3–127； UniProt 961–1085 Author chain E； PDBConstruct 3–127； UniProt 961–1085 Author chain G； PDBConstruct 3–127； UniProt 961–1085 Author chain I； PDBConstruct 3–127； UniProt 961–1085 Author chain K； PDBConstruct 3–127； UniProt 961–1085 Author chain M； PDBConstruct 3–127； UniProt 961–1085 Author chain O； PDBConstruct 3–127； UniProt 961–1085

Silent chromatin protein ESC1

OrganismNot specified

UniProt Q03661

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein SIR4 × 1 （P11978） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein SIR4 × 1 （P11978） CHLORIDE ION × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein SIR4 × 1 （P11978） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein SIR4 × 1 （P11978） water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein SIR4 × 1 （P11978） water × 2	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein SIR4 × 1 （P11978） water × 2	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein SIR4 × 1 （P11978） water × 2	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 2	Regulatory protein SIR4 × 1 （P11978） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ESC1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–16； UniProt 1443–1458 Author chain D； PDBConstruct 1–16； UniProt 1443–1458 Author chain F； PDBConstruct 1–16； UniProt 1443–1458 Author chain H； PDBConstruct 1–16； UniProt 1443–1458 Author chain J； PDBConstruct 1–16； UniProt 1443–1458 Author chain L； PDBConstruct 1–16； UniProt 1443–1458 Author chain N； PDBConstruct 1–16； UniProt 1443–1458 Author chain P； PDBConstruct 1–16； UniProt 1443–1458

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6qsz
Deposition date deposition_date	2019-02-22
Structure title title	Crystal structure of the Sir4 H-BRCT domain in complex with Esc1 pS1450 peptide
Keywords keywords	Heterochromatin, NUCLEAR PROTEIN; NUCLEAR PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6qsz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6qsz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6qsz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	15.86 Å
Rg (electron density)	14.49 Å
Total Rg	15.67 Å
Atom count	997
Residues	116
Excluded volume	17828 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6qsz__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6qsz__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6qsz__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6qsz__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`6qsz__assembly_5__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`6qsz__assembly_6__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`6qsz__assembly_7__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`6qsz__assembly_8__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Regulatory protein SIR4
Molecular weight formula_weight	15059.5 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O
Atom count atom_count	8262

GPKPKNTKENLSKSSWRQEWLANLKLISVSLVDEFPSELSDSDRQIINEKMQLLKDIFANNLKSAISNNFRESDIIILKGEIEDYPMSSEIKIYYNELQNKPDAKKARFWSFMKTQRFVSNMGFDIQ

Source Source

Source organism organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Common name common_name	;Baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	559292
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Silent chromatin protein ESC1
Molecular weight formula_weight	1807.8 kDa
Source method src_method	syn
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P

IPSTDLPSDPPSDKEE

Entity 3 Entity 3 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	182

▶

Unit-cell length a length_a	65.060 Å
Unit-cell length b length_b	68.340 Å
Unit-cell length c length_c	77.810 Å
Unit-cell angle α angle_alpha	72.61 °
Unit-cell angle β angle_beta	84.10 °
Unit-cell angle γ angle_gamma	87.41 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.500 Å
Low-resolution limit resolution_low	46.580 Å
R factor r_factor	0.1916
R_work r_work	0.1893
R_free r_free	0.2339

Crystal structure of the Sir4 H-BRCT domain in complex with Esc1 pS1450 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Regulatory protein SIR4

State in the Current Structure

Other States of the Same Protein in the Database

Silent chromatin protein ESC1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qsz__assembly_1__model_1

6qsz__assembly_1__model_1 | I(q)

6qsz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of the Sir4 H-BRCT domain in complex with Esc1 pS1450 peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Regulatory protein SIR4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Silent chromatin protein ESC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6qsz__assembly_1__model_1

6qsz__assembly_1__model_1 | I(q)

6qsz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)