SAXSdb — 6rjf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 240	VP4 × 60 PALMITIC ACID × 60	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_EC01F
Isoform	—
PDB entities	1, 2, 3
Chains and sequence ranges	Author chain 1； PDBConstruct 1–281； UniProt 570–850 Author chain 2； PDBConstruct 1–261； UniProt 70–330 Author chain 3； PDBConstruct 1–239； UniProt 331–569

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6rjf
Deposition date deposition_date	2019-04-26
Structure title title	Echovirus 1 intact particle
Keywords keywords	VIRAL COAT PROTEIN, CAPSID, PICORNAVIRUS, ECHOVIRUS, ICOSAHEDRAL VIRUS, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6rjf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6rjf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6rjf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	134.40 Å
Total Rg	134.30 Å
Atom count	769260
Residues	50160
Excluded volume	6942200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6rjf__assembly_1__model_1`	240-meric （240）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	VP1
Molecular weight formula_weight	31604.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	12821

GDVQNAVEGAMVRVADTVQTSATNSERVPNLTAVETGHTSQAVPGDTMQTRHVINNHVRSESTIENFLARSACVFYLEYKTGTKEDSNSFNNWVITTRRVAQLRRKLEMFTYLRFDMEITVVITSSQDQSTSQNQNAPVLTHQIMYVPPGGPIPVSVDDYSWQTSTNPSIFWTEGNAPARMSIPFISIGNAYSNFYDGWSHFSQAGVYGFTTLNNMGQLFFRHVNKPNPAAITSVARIYFKPKHVRAWVPRPPRLCPYINSTNVNFEPKPVTEVRTNIITT

Entity 2 Entity 2 polymer

Description description	VP2
Molecular weight formula_weight	28872.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SPTVEECGYSDRVRSITLGNSTITTQECANVVVGYGEWPEYLSDNEATAEDQPTQPDVATCRFYTLDSVQWENGSPGWWWKFPDALRDMGLFGQNMYYHYLGRAGYTIHVQCNASKFHQGCILVVCVPEAEMGSAQTSGVVNYEHISKGEIASRFTTTTTAEDHGVQAAVWNAGMGVGVGNLTIFPHQWINLRTNNSATIVMPYVNSVPMDNMYRHHNFTLMIIPFVPLDFSAGASTYVPITVTVAPMCAEYNGLRLAGHQ

Entity 3 Entity 3 polymer

Description description	VP3
Molecular weight formula_weight	26471.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPTMNTPGSNQFLTSDDFQSPSAMPQFDVTPEMHIPGEVRNLMEIAEVDSVMPINNDSAAKVSSMEAYRVELSTNTNAGTQVFGFQLNPGAESVMNRTLMGEILNYYAHWSGSIKITFVFCGSAMTTGKFLLSYAPPGAGAPKTRKDAMLGTHVVWDVGLQSSCVLCIPWISQTHYRFVEKDPYTNAGFVTCWYQTSVVSPASNQPKCYMMCMVSACNDFSVRMLRDTKFIEQTSFYQ

Entity 4 Entity 4 polymer

Description description	VP4
Molecular weight formula_weight	7398.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAQVSTQKTGAHETSLSATGNSIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPMKDVMIKTLPALN

Entity 5 Entity 5 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	6rjf100
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6rjf200
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	6rjf300
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	45309

Echovirus 1 intact particle

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6rjf__assembly_1__model_1

6rjf__assembly_1__model_1 | I(q)

6rjf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (3)

Echovirus 1 intact particle

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6rjf__assembly_1__model_1

6rjf__assembly_1__model_1 | I(q)

6rjf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (3)