SAXSdb — 6s9j

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-glycoprotein polyprotein GP complex

Machupo virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 2 其他Polymer 1	Transferrin receptor 1,Transferrin receptor 1 × 1 （A0A060BIS8） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 water × 2	Consistent with protein count
2	Other combination	Heteromer	Protein 2 其他Polymer 1	Transferrin receptor 1,Transferrin receptor 1 × 1 （A0A060BIS8） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Transferrin receptor 1,Transferrin receptor 1 × 1 （A0A060BIS8） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Transferrin receptor 1,Transferrin receptor 1 × 1 （A0A060BIS8） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8AZ57_MACHU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–160； UniProt 85–244 Author chain D； PDBConstruct 1–160； UniProt 85–244 Author chain F； PDBConstruct 1–160； UniProt 85–244 Author chain H； PDBConstruct 1–160； UniProt 85–244

Transferrin receptor 1,Transferrin receptor 1

Neotoma albigula

UniProt A0A060BIS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 2 其他Polymer 1	Pre-glycoprotein polyprotein GP complex × 1 （Q8AZ57） ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 water × 2	Consistent with protein count
2	Other combination	Heteromer	Protein 2 其他Polymer 1	Pre-glycoprotein polyprotein GP complex × 1 （Q8AZ57） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Pre-glycoprotein polyprotein GP complex × 1 （Q8AZ57） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Pre-glycoprotein polyprotein GP complex × 1 （Q8AZ57） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A060BIS8_NEOAL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–111； UniProt 190–301 Author chain A； PDBConstruct 112–168； UniProt 328–384 Author chain C； PDBConstruct 1–111； UniProt 190–301 Author chain C； PDBConstruct 112–168； UniProt 328–384 Author chain E； PDBConstruct 1–111； UniProt 190–301 Author chain E； PDBConstruct 112–168； UniProt 328–384 Author chain G； PDBConstruct 1–111； UniProt 190–301 Author chain G； PDBConstruct 112–168； UniProt 328–384

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6s9j
Deposition date deposition_date	2019-07-15
Structure title title	Crystal structure of TfR1 mimicry in complex with GP1 from MACV
Keywords keywords	Immunotherapy, glycoprotein, Viral, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6s9j__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6s9j__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6s9j__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	21.63 Å
Rg (electron density)	20.79 Å
Total Rg	21.60 Å
Atom count	2520
Residues	306
Excluded volume	44680 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6s9j__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6s9j__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6s9j__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`6s9j__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Pre-glycoprotein polyprotein GP complex
Molecular weight formula_weight	19343.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H
Atom count atom_count	9715

SNELPSLCMLNNSFYYMRGGVNTFLIRVSDISVLMKEYDVSIYEPEDLGNCLNKSDSSWAIHWFSNALGHDWLMDPPMLCRNKTKKEGSNIQFNISKADDARVYGKKIRNGMRHLFRGFHDPCEEGKVCYLTINQCGDPSSFDYCGVNHLSKCQFDHVNTGSHHHHHH

Source Source

Source organism organism	Machupo virus
Common name common_name	MACV
NCBI taxonomy ID ncbi_taxonomy_id	11628
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Transferrin receptor 1,Transferrin receptor 1
Molecular weight formula_weight	19651.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G

KIQVKCSAPNSVTITNASGGLYLVEYPEGYVAYSKATEVTGKLVHANFGTKKDFEDLDYAVNGSIVIVRAGKITIAEKVANAQSFNAIGVLIYKDRTKYPISRADEPLQGHSGLPSIPVQTISREAAEKLFQNMERDCPRSWNTDSSCKLELLQNRNVKLTVNNCLKEGTSGHHHHHH

Source Source

Source organism organism	Neotoma albigula
Common name common_name	White-throated woodrat
NCBI taxonomy ID ncbi_taxonomy_id	42408
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 branched

Description description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	man
Copy count entity_count	1

Entity 4 Entity 4 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	3

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	42

▼

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

Domain ID domain_id	6s9jA00
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	30 — Glucose Oxidase; domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	6s9jC00
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	30 — Glucose Oxidase; domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	6s9jE00
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	30 — Glucose Oxidase; domain 1
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	6s9jG00
Class class	3 — Alpha Beta
Architecture architecture	50 — 3-Layer(bba) Sandwich
Topology topology	30 — Glucose Oxidase; domain 1
Homologous superfamily homologous superfamily	30 —

▶

Unit-cell length a length_a	104.626 Å
Unit-cell length b length_b	104.626 Å
Unit-cell length c length_c	281.363 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 43 2 2
Space-group number int_tables_number	95
Crystal system crystal_system	—

Resolution resolution	2.698 Å
Low-resolution limit resolution_low	49.559 Å
R factor r_factor	0.2426
R_work r_work	0.2412
R_free r_free	0.2665

Crystal structure of TfR1 mimicry in complex with GP1 from MACV

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-glycoprotein polyprotein GP complex

State in the Current Structure

Other States of the Same Protein in the Database

Transferrin receptor 1,Transferrin receptor 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6s9j__assembly_1__model_1

6s9j__assembly_1__model_1 | I(q)

6s9j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of TfR1 mimicry in complex with GP1 from MACV

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-glycoprotein polyprotein GP complex

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Transferrin receptor 1,Transferrin receptor 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6s9j__assembly_1__model_1

6s9j__assembly_1__model_1 | I(q)

6s9j__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 branched

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 4 domains

CATH v4.4 (4 domains)

7. Citations (1)