SAXSdb — 6sur

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ras-related protein Rab-33B

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Autophagy-related protein 16-1 × 2 （Q8C0J2） MAGNESIUM ION × 2 GUANOSINE-5'-TRIPHOSPHATE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Autophagy-related protein 16-1 × 2 （Q8C0J2） MAGNESIUM ION × 2 GUANOSINE-5'-TRIPHOSPHATE × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Autophagy-related protein 16-1 × 2 （Q8C0J2） MAGNESIUM ION × 2 GUANOSINE-5'-TRIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RB33B_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–173； UniProt 30–202 Author chain B； PDBConstruct 1–173； UniProt 30–202 Author chain C； PDBConstruct 1–173； UniProt 30–202 Author chain D； PDBConstruct 1–173； UniProt 30–202 Author chain E； PDBConstruct 1–173； UniProt 30–202 Author chain F； PDBConstruct 1–173； UniProt 30–202

Autophagy-related protein 16-1

Mus musculus

UniProt Q8C0J2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Ras-related protein Rab-33B × 2 （O35963） MAGNESIUM ION × 2 GUANOSINE-5'-TRIPHOSPHATE × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Ras-related protein Rab-33B × 2 （O35963） MAGNESIUM ION × 2 GUANOSINE-5'-TRIPHOSPHATE × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Ras-related protein Rab-33B × 2 （O35963） MAGNESIUM ION × 2 GUANOSINE-5'-TRIPHOSPHATE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A16L1_MOUSE
Isoform	Q8C0J2-5
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–57； UniProt 154–210 Author chain J； PDBConstruct 1–57； UniProt 154–210 Author chain K； PDBConstruct 1–57； UniProt 154–210 Author chain L； PDBConstruct 1–57； UniProt 154–210 Author chain M； PDBConstruct 1–57； UniProt 154–210 Author chain N； PDBConstruct 1–57； UniProt 154–210

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6sur
Deposition date deposition_date	2019-09-16
Structure title title	The Rab33B-Atg16L1 crystal structure
Keywords keywords	Autophagy, cell cycle; CELL CYCLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6sur__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6sur__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6sur__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.40 Å
Rg (electron density)	27.97 Å
Total Rg	28.46 Å
Atom count	3581
Residues	442
Excluded volume	62975 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6sur__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`6sur__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`6sur__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Ras-related protein Rab-33B
Molecular weight formula_weight	19896.8 kDa
Mutation mutation	Q92L
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	10672

RSRIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGLERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPAWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSH

Source Source

Source organism organism	Mus musculus
Common name common_name	House mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Autophagy-related protein 16-1
Molecular weight formula_weight	6690.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L,M,N

DLEVANQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENE

Source Source

Source organism organism	Mus musculus
Common name common_name	House mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	man
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	man
Copy count entity_count	6

▶

Unit-cell length a length_a	48.400 Å
Unit-cell length b length_b	204.900 Å
Unit-cell length c length_c	107.200 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.60 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.467 Å
Low-resolution limit resolution_low	48.350 Å
R factor r_factor	0.2073
R_work r_work	0.2056
R_free r_free	0.2388

The Rab33B-Atg16L1 crystal structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ras-related protein Rab-33B

State in the Current Structure

Other States of the Same Protein in the Database

Autophagy-related protein 16-1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6sur__assembly_1__model_1

6sur__assembly_1__model_1 | I(q)

6sur__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Citations (1)

The Rab33B-Atg16L1 crystal structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ras-related protein Rab-33B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Autophagy-related protein 16-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6sur__assembly_1__model_1

6sur__assembly_1__model_1 | I(q)

6sur__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Citations (1)