SAXSdb — 6uth

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha

Thermoplasma acidophilum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit beta × 14 （P28061） Proteasome activator protein PA26 × 7 （Q38BM8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA_THEAC
Isoform	—
PDB entities	1, 3
Chains and sequence ranges	Author chain A； PDBConstruct 1–227； UniProt 7–233 Author chain B； PDBConstruct 1–227； UniProt 7–233 Author chain C； PDBConstruct 1–227； UniProt 7–233 Author chain D； PDBConstruct 1–227； UniProt 7–233 Author chain E； PDBConstruct 1–227； UniProt 7–233 Author chain F； PDBConstruct 1–227； UniProt 7–233 Author chain G； PDBConstruct 1–227； UniProt 7–233 Author chain O； PDBConstruct 1–227； UniProt 7–233 Author chain P； PDBConstruct 1–227； UniProt 7–233 Author chain Q； PDBConstruct 1–227； UniProt 7–233 Author chain R； PDBConstruct 1–227； UniProt 7–233 Author chain S； PDBConstruct 1–227； UniProt 7–233 Author chain T； PDBConstruct 1–227； UniProt 7–233 Author chain U； PDBConstruct 1–227； UniProt 7–233

Proteasome subunit beta

Thermoplasma acidophilum

UniProt P28061

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha × 7 （P25156） Proteasome subunit alpha × 7 （P25156） Proteasome activator protein PA26 × 7 （Q38BM8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB_THEAC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–203； UniProt 9–211 Author chain 2； PDBConstruct 1–203； UniProt 9–211 Author chain H； PDBConstruct 1–203； UniProt 9–211 Author chain I； PDBConstruct 1–203； UniProt 9–211 Author chain J； PDBConstruct 1–203； UniProt 9–211 Author chain K； PDBConstruct 1–203； UniProt 9–211 Author chain L； PDBConstruct 1–203； UniProt 9–211 Author chain M； PDBConstruct 1–203； UniProt 9–211 Author chain N； PDBConstruct 1–203； UniProt 9–211 Author chain V； PDBConstruct 1–203； UniProt 9–211 Author chain W； PDBConstruct 1–203； UniProt 9–211 Author chain X； PDBConstruct 1–203； UniProt 9–211 Author chain Y； PDBConstruct 1–203； UniProt 9–211 Author chain Z； PDBConstruct 1–203； UniProt 9–211

Proteasome activator protein PA26

Trypanosoma brucei brucei

UniProt Q38BM8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Proteasome subunit alpha × 7 （P25156） Proteasome subunit beta × 14 （P28061） Proteasome subunit alpha × 7 （P25156）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q38BM8_TRYB2
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain a； PDBConstruct 1–220； UniProt 4–223 Author chain b； PDBConstruct 1–220； UniProt 4–223 Author chain c； PDBConstruct 1–220； UniProt 4–223 Author chain d； PDBConstruct 1–220； UniProt 4–223 Author chain e； PDBConstruct 1–220； UniProt 4–223 Author chain f； PDBConstruct 1–220； UniProt 4–223 Author chain g； PDBConstruct 1–220； UniProt 4–223

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6uth
Deposition date deposition_date	2019-10-29
Structure title title	Allosteric coupling between alpha-rings of 20S proteasome, 20S proteasome singly capped with a PA26/E102A_PANc, together with LFP incubation
Keywords keywords	PA26PANc, proteasome, substrate LFP, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6uth__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6uth__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6uth__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	70.15 Å
Rg (electron density)	70.15 Å
Total Rg	70.07 Å
Atom count	58394
Residues	7553
Excluded volume	1048100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6uth__assembly_1__model_1`	35-meric （35）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit alpha
Molecular weight formula_weight	25067.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G
Atom count atom_count	58394

AYDRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEAIQLIDDYVAAVTSGLVADARVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQIGPRLFDCDPAGTINEYKATAIGSGKDAVVSFLEREYKENLPEKEAVTLGIKALKSSLEEGEELKAPEIASITVGNKYRIYDQEEVKKFL

Source Source

Source organism organism	Thermoplasma acidophilum
NCBI taxonomy ID ncbi_taxonomy_id	2303
Host organism host_organism	Escherichia phage EcSzw-2

Entity 2 Entity 2 polymer

Description description	Proteasome subunit beta
Molecular weight formula_weight	22294.8 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	14

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z,M,1,N,2,H,V,I,W,J,X,K,Y,L

TTTVGITLKDAVIMATERRVTMENFIMHKNGKKLFQIDTYTGMTIAGLVGDAQVLVRYMKAELELYRLQRRVNMPIEAVATLLSNMLNQVKYMPYMVQLLVGGIDTAPHVFSIDAAGGSVEDIYASTGSGSPFVYGVLESQYSEKMTVDEGVDLVIRAISAAKQRDSASGGMIDVAVITRKDGYVQLPTDQIESRIRKLGLIL

Source Source

Source organism organism	Thermoplasma acidophilum
NCBI taxonomy ID ncbi_taxonomy_id	2303
Host organism host_organism	Escherichia phage EcSzw-2

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha
Molecular weight formula_weight	25125.6 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,P,Q,R,S,T,U

AYDRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEKIQLIDDYVAAVTSGLVADARVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQIGPRLFDCDPAGTINEYKATAIGSGKDAVVSFLEREYKENLPEKEAVTLGIKALKSSLEEGEELKAPEIASITVGNKYRIYDQEEVKKFL

Source Source

Source organism organism	Thermoplasma acidophilum
NCBI taxonomy ID ncbi_taxonomy_id	2303
Host organism host_organism	Escherichia phage EcSzw-2

Entity 4 Entity 4 polymer

Description description	Proteasome activator protein PA26
Molecular weight formula_weight	25088.6 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g

KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAVEAHGTIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKVIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGSVDAESGKTKGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRGGHLDVLYR

Source Source

Source organism organism	Trypanosoma brucei brucei
NCBI taxonomy ID ncbi_taxonomy_id	5691
Host organism host_organism	Escherichia phage EcSzw-2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	55000

Allosteric coupling between alpha-rings of 20S proteasome, 20S proteasome singly capped with a PA26/E102A_PANc, together with LFP incubation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Proteasome subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Proteasome activator protein PA26

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6uth__assembly_1__model_1

6uth__assembly_1__model_1 | I(q)

6uth__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

Allosteric coupling between alpha-rings of 20S proteasome, 20S proteasome singly capped with a PA26/E102A_PANc, together with LFP incubation

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome activator protein PA26

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6uth__assembly_1__model_1

6uth__assembly_1__model_1 | I(q)

6uth__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)