6v8o

RSC core

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

High temperature lethal protein 1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HTL1_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 1–78； UniProt 1–78

Chromatin structure-remodeling complex protein RSC14

OrganismNot specified

UniProt P38210

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LDB7_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–180； UniProt 1–180

Chromatin structure-remodeling complex subunit RSC7

OrganismNot specified

UniProt P32832

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC7_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–435； UniProt 1–435

Chromatin structure-remodeling complex subunit RSC2

OrganismNot specified

UniProt Q06488

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC2_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–889； UniProt 1–889

Chromatin structure-remodeling complex protein RSC3

OrganismNot specified

UniProt Q06639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC3_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–885； UniProt 1–885

Chromatin structure-remodeling complex subunit RSC4

OrganismNot specified

UniProt Q02206

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC4_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain H； PDBConstruct 1–625； UniProt 1–625

Chromatin structure-remodeling complex protein RSC8

OrganismNot specified

UniProt P43609

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC8_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–557； UniProt 1–557 Author chain J； PDBConstruct 1–557； UniProt 1–557 Author chain K； PDBConstruct 1–557； UniProt 1–557 Author chain L； PDBConstruct 1–557； UniProt 1–557

Chromatin structure-remodeling complex protein RSC6

OrganismNot specified

UniProt P25632

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC6_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain M； PDBConstruct 1–483； UniProt 1–483

Chromatin structure-remodeling complex subunit RSC9

OrganismNot specified

UniProt Q03124

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC9_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain N； PDBConstruct 1–581； UniProt 1–581

Chromatin structure-remodeling complex protein RSC58

OrganismNot specified

UniProt Q07979

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC58_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain O； PDBConstruct 1–502； UniProt 1–502

Chromatin structure-remodeling complex subunit SFH1

OrganismNot specified

UniProt Q06168

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Nuclear protein STH1/NPS1 × 1 （P32597） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SFH1_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Q； PDBConstruct 1–426； UniProt 1–426

Nuclear protein STH1/NPS1

OrganismNot specified

UniProt P32597

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Chromatin structure-remodeling complex protein RSC30 × 1 （P38781） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STH1_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain R； PDBConstruct 1–1359； UniProt 1–1359

Chromatin structure-remodeling complex protein RSC30

OrganismNot specified

UniProt P38781

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 22	High temperature lethal protein 1 × 1 （Q9URQ5） Chromatin structure-remodeling complex protein RSC14 × 1 （P38210） Chromatin structure-remodeling complex subunit RSC7 × 1 （P32832） Chromatin structure-remodeling complex subunit RSC2 × 1 （Q06488） Chromatin structure-remodeling complex protein RSC3 × 1 （Q06639） Chromatin structure-remodeling complex subunit RSC4 × 1 （Q02206） Chromatin structure-remodeling complex protein RSC8 × 4 （P43609） Chromatin structure-remodeling complex protein RSC6 × 1 （P25632） Chromatin structure-remodeling complex subunit RSC9 × 1 （Q03124） Chromatin structure-remodeling complex protein RSC58 × 1 （Q07979） Chromatin structure-remodeling complex subunit SFH1 × 1 （Q06168） Nuclear protein STH1/NPS1 × 1 （P32597） Unknown protein × 1 Unknown Protein × 2 Unknown protein × 1 Unknown Protein × 1 Unknown Protein × 1 ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSC30_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain S； PDBConstruct 1–883； UniProt 1–883

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6v8o
Deposition date deposition_date	2019-12-11
Structure title title	RSC core
Keywords keywords	Chromatin remodeler, RSC, GENE REGULATION; GENE REGULATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6v8o__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6v8o__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6v8o__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.02 Å
Rg (electron density)	59.02 Å
Total Rg	59.06 Å
Atom count	25103
Residues	3156
Excluded volume	447700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6v8o__assembly_1__model_1`	22-meric （22）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (19)

Entity 1 Entity 1 polymer

Description description	High temperature lethal protein 1
Molecular weight formula_weight	9192.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	25103

MSQNNTISSMNPERAYNNVTLKNLTAFQLLSQRENICELLNLVESTERHNSIINPERQRMSLEEMKKMLDALKNERKK

Entity 2 Entity 2 polymer

Description description	Chromatin structure-remodeling complex protein RSC14
Molecular weight formula_weight	19825.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSGSNMGYYDVLAGLSALEKSSQVVFSATELQQLTQQSHATDKGIEGSENSKAKVSKPKRVAVHGYLGGKVSLADAAQVEYEVGHSLLGSYVPRQQLEALSSVDFSHHFHRTLECKAALETHDVFLAGAGQLSLPFQSHIESPRNSEAKRKRKVIICKRCQSRFIGSHRRSQLREHACVD

Entity 3 Entity 3 polymer

Description description	Chromatin structure-remodeling complex subunit RSC7
Molecular weight formula_weight	49716.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSDSEGGLASEVEHEKRSRSTSNRPNYAIDTEDLDIDENDENEDDDYREEEANEGVNEEEISDEEEQINKSGRNKRRHVDEEEDLSEDKGVTRSRNRSKFKKPVFPGIDDAEENLNPLKVVNEEYVLPDDPEGETKITADGDLLGGREFLVRTFTLTEKGNRKFMLATEPARIVGFRDSYLFFQTHPNLYKFILNQTQKNDLIDRGVLPYSYRNRQIALVTARGVFKEFGAKIIRGGKHITDDYYASELRTKGNVIEGKLAGDPIDKSARALETMMYPASENGINPAKNQVEFFEHRPHGHMSNSNIIASGSKLSSTNWLYQHSAACSRFNSDLFYDRVKVLLVDQQGLRDAYTNILHIPESTQSTTVLGWRRSKNDSPSDTSIVYETVIHDNDLNKPKTGLSEIPKEIYEDVVDEDVLRAITEQQNFEKCNEYI

Entity 4 Entity 4 polymer

Description description	Chromatin structure-remodeling complex subunit RSC2
Molecular weight formula_weight	102443.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MMPDDNSNSSTQNSSALYKDLRKEYESLFTLKEDSGLEISPIFNVLPPKKDYPDYYAVIKNPVSFNTLKKRIPHYTDAQQFMNDVVQIPWNAKTYNTRDSGIYKYALVLEKYLKDTIYPNLKEKYPQLVYPDLGPLPDEPGYEEFQQKLREKAEEVARANAARAESSSSMNSTEAARRLRKTRTSVKRESEPGTDTNNDEDYEATDMDIDNPKDADFPDLIRKPLININPYTRKPLRDNRSTTPSHSGTPQPLGPRHRQVSRTQVKRGRPPIIDLPYIQRMKNVMKVLKKEVLDSGIGLTDLFERLPDRHRDANYYIMIANPISLQDINKKVKTRRYKTFQEFQNDFNLMLTNFRISHRGDPESIKISNILEKTFTSLARFELSKPDRSFIPEGELRYPLDEVIVNNISYHVGDWALLRNQNDPQKPIVGQIFRLWKTPDGKQWLNACWYYRPEQTVHRVDRLFYKNEVMKTGQYRDHLVSNLVGKCYVIHFTRYQRGNPDMKLEGPLFVCEFRYNESDKIFNKIRTWKACLPEEIRDLDEATIPVNGRKFFKYPSPIRHLLPANATPHDRVPEPTMGSPDAPPLVGAVYMRPKMQRDDLGEYATSDDCPRYIIRPNDSPEEGQVDIETGTITTNTPTANALPKTGYSSSKLSSLRYNRSSMSLENQNAIGQQQIPLSRVGSPGAGGPLTVQGLKQHQLQRLQQQQHQYQQQKRSQASRYNIPTIIDDLTSQASRGNLGNIMIDAASSFVLPISITKNVDVLQRTDLHSQTKRSGREEMFPWKKTKGEILWFRGPSVIVNERIINSGDPHLSLPLNRWFTTNKKRKLEYEEVEETMEDVTGKDKDDDGLEPDVENEKESLPGPFVLGLRPSAKFTAHRLSMLRPPSSSS

Entity 5 Entity 5 polymer

Description description	Chromatin structure-remodeling complex protein RSC3
Molecular weight formula_weight	101819.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDIRGRKMKKPPACVQCRKRKIGCDRVKPICGNCMKHNKMDCFYPDVPGQYVPSSSSSSNTRQVANGPYLNSYYASRRVSKETAALLQKNPELASLEQIREYNTRLQLLNAQNQLNNRSSAANATLNQQHTQYIPKSVPSLESKPVTSANESSTPLNWVQGPAIFHMLTSPYTQDEIINHEMNFLKGRLLELQEITGKKITGVNLDLKQDSSAQMQSSHSNRNQEEFLTIKKRKLSEDGVTDGDGKPIPESERRPHLNEFKDLDPQFLDTNKVFNVFNSAISEEGRNRLWLLPKNINKSSIFQIQYLIERDPFLFKFFNDLNILIETQFNGPLHDLVASRNSIERNSGISQILKFPSQSITQTLINKYLSTITETNSILPILKPKRLLPIVEQLFPSNTINKPNSKDFETIFQVFSVTNDQLLNLGFITLCLLILFESLNSTVLIPLRDDEHLQLFNVLFNYLPLLKSNLTTLRFEIEKRSMCNIETLRFISLWKYYQFVMDTSSSSSFVIDYDEDMHMACLLSLNHETQNQSHILTWNFIFKNYCWRHLFLGQLPLLMSEPFTNSTPIIDPLLNNDFELIDFEVNLMKYLQSKDQQLSIDKIIQLIKLLKNKNIEVSQGCLTTPSIINNIMDSLIYRNSMLYLNFYLLLQFETLKNYAKFNEILEDFLELSRETLFFVFSNLANIKFAGHEFTFINKSIVVLQTLVLMLLALYQRSFDSSKRTNDANEISEQTDIHSNNDNSKRIKNKNVIHLIINKIAMLLSDYSKNCKKQNKLIENLIIKIKTISKYIKNLEENKVTTSADSNYSINNGFSGISAEQLIKLNHELSKISESLIKTDFYEQRKNSTVSNGVLGAAAPVDSDANSDTFGLTKENFNEVFEAIRS

Entity 6 Entity 6 polymer

Description description	Chromatin structure-remodeling complex subunit RSC4
Molecular weight formula_weight	72372.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MVVKKRKLATEAGGSDERPKYLPGKHPKNQEKTPHVDYNAPLNPKSELFLDDWHIPKFNRFISFTLDVLIDKYKDIFKDFIKLPSRKFHPQYYYKIQQPMSINEIKSRDYEYEDGPSNFLLDVELLTKNCQAYNEYDSLIVKNSMQVVMLIEFEVLKAKNLKRNYLINSEVKAKLLHYLNKLVDATEKKINQALLGASSPKNLDDKVKLSEPFMELVDKDELPEYYEIVHSPMALSIVKQNLEIGQYSKIYDFIIDMLLVFQNAHIFNDPSALIYKDATTLTNYFNYLIQKEFFPELQDLNERGEINLEFDKFEFENYLAIGGGGPAAAGALAISALDNDIEPESNREDLIDQADYDFNHFEGLGNGYNRSLLTEDYLLNPNNFKKLIAKPETVQSEVKNERSTTSDIEKTNSLESEHLKIPKYNVIKSMQKEMQSLSEQHTMEYKPYKLIQQIYIFSSKNLYSQATKPLLGSRPSCNQNWVEYIFNGNELSQNENAFSFMLQPMQTFLTLQSHLTSSLKDTETLLTINKEPVKSRTSNVNSNLSQPQQQENDVIGNDTKQDIENLTIGGGNNNDIVGNDNDKRNNITEIFDIRLSEGLNHLMFRCEDKISHETEFMNFWINVLP

Entity 7 Entity 7 polymer

Description description	Chromatin structure-remodeling complex protein RSC8
Molecular weight formula_weight	63254.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J,K,L

MSDTEKDKDVPMVDSHEATEEPPTTSTNTPSFPHLAQEQAKEESATLGAEVAHKKINYEQEAQKLEEKALRFLAKQTHPVIIPSFASWFDISKIHEIEKRSNPDFFNDSSRFKTPKAYKDTRNFIINTYRLSPYEYLTITAVRRNVAMDVASIVKIHAFLEKWGLINYQIDPRTKPSLIGPSFTGHFQVVLDTPQGLKPFLPENVIKQEVEGGDGAEPQVKKEFPVNLTIKKNVYDSAQDFNALQDESRNSRQIHKVYICHTCGNESINVRYHNLRARDTNLCSRCFQEGHFGANFQSSDFIRLENNGNSVKKNWSDQEMLLLLEGIEMYEDQWEKIADHVGGHKRVEDCIEKFLSLPIEDNYIREVVGSTLNGKGGDSRDGSVSGSKLMECVNDAVQTLLQGDDKLGKVSDKSREISEKYIEESQAIIQELVKLTMEKLESKFTKLCDLETQLEMEKLKYVKESEKMLNDRLSLSKQILDLNKSLEELNVSKKLVLISEQVDSGIQLVEKDQEGDDEDGNTATGHGVKRVGKEGEEVGEGDSIAKLQPQVYKPWSL

Entity 8 Entity 8 polymer

Description description	Chromatin structure-remodeling complex protein RSC6
Molecular weight formula_weight	54222.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MVTQTNPVPVTYPTDAYIPTYLPDDKVSNLADLKKLIEMDSRLDLYLTRRRLDTSINLPTNTKTKDHPPNKEMLRIYVYNTTESSPRSDSGTPADSGKTTWTLRIEGKLLHESANGKHPFSEFLEGVAVDFKRLKPLGMGKKRKRDSSLSLPLNLQQPEYNDQDSTMGDNDNGEDEDSAEAESREEIVDALEWNYDENNVVEFDGIDIKRQGKDNLRCSITIQLRGVDGGKVQYSPNLATLIGMQTGSVNDAVYSIYKYILINNLFVTEQTEAQDGSNDAEDSSNENNNKNGAGDDDGVEGSTPKDKPELGEVKLDSLLQKVLDTNAAHLPLMNVVQTVNKLVSPLPPIILDYTIDLSKDTTYGATTLDVDVSHILHQPQPQPNLQKEEETDAEDTAKLREITKLALQLNSSAQKYQFFHELSLHPRETLTHYLWSSKQNELVLQGDQYFNEDAARTSDIYSNNNNDRSLMGNISLLYSQGRL

Entity 9 Entity 9 polymer

Description description	Chromatin structure-remodeling complex subunit RSC9
Molecular weight formula_weight	65289.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MNSLASNTPLNGTPVSEAPATSSEPVNMFETMVANPIKVSRLQSNGVLTGPAANTKSIHYSLANFNVFQSLPKETARGVDDLTRMEMALLSGIPEEIKWSLKKYLTYSNKAPYMISLRTLPDLLPLFKTFILPLERIVEGLNKSSICDSKAMDSLQMGLNALLILRNLAQDTDSVQILVKDREIKSFILFILKKFQCVATGDNKWQLYEGNATFFNELTHYTLDLMEAISSYIAPAMKDDHYFQTLVSILNYTKDRYMVISILRSLSRLLVRSKANEESAADNLDHKTLSLIVSFLLLECDSELIIASLDFLYQYILPGSQRITELFKSKECSLILEATLPNLLSYNIATPDYHLLQKHKIRLIKRLKPPAPKEPPNLSEDLFQQLFKLNEPLRSTAWLRCCFEPVQEAEFTQISLWRSYESKFGQPVRESGRKLLPAVEFIKNVSNAFNNAAAIVITDPVTGKKRFVIKGIQPRFKALGIADGERESQVPISALKSKFLNDSKEITPARQNSIPEVKFPQELSDVSKVACTFLCLLSNDTDDGAGSAFCQRIRPLVLHKLADIPPLTLALSEYMENTSGL

Entity 10 Entity 10 polymer

Description description	Chromatin structure-remodeling complex protein RSC58
Molecular weight formula_weight	57871.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MTESVGGNKLVDFLVNVQSILNAASVKCHVVDESFPAKFFEKNPDKIYESYCKFIKNRSNSEGLIRNEDKLVLTTINKRFENGEYEPIQGGFYKLYHDIKLVCTILIHFYPQGTRNYQLVDKFYKFSSELLLRECCRIGIALTQTNNIKSRSGKLLSGNEMDEYDDDDATELDKIISYDFIKISMNYTVPISQTYQIRTKDMDLFSSIISKSNLDKRPHELPNTNFKINNVLPQTDIENEAPRLGFVGANTSNIPDPTLPPTEMMTRFLHPNWYALPTTVWLKYGNYNSWAPSFNENGTVVDSTTRGLIWLERIGYMDLYEKNEKKVKQEELLNTNEEGINRKQNDENNKNVDGKSNGVQDDGGDNDNDATIASANSESTENKEQFIIKLQNLYNWTPSNYIGDDEIENFRNGTPDKLVSDSLLKLKRLRKERILNKVLKPTTEERELYFKVKRILKEVILAKKVSKVPINNVRAFPVLQTNYNGSIPVVRAQPGRKRKHKK

Entity 11 Entity 11 polymer

Description description	Chromatin structure-remodeling complex subunit SFH1
Molecular weight formula_weight	48833.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSHQNQLIPQAYISNFHNRLTNEDDGIPIFTMAQQTRQHKRAKVVNYAEYDNDLFDEFNMNGSNFNNADTHYKDNAVSHENTPALTNGVTMDGSEYNVLENMNGADSIISNNKYDAGSNMVVESLSGLNSNNNASNGPSNKAQAQDIGNAVLPDLQDQHHNPFNILRYPKIRDTFINGKVVSPYRLNTDQETKANANSGEAIMIPITLDIEHMGHTIKDQFLWNYNDDSISPEEFASIYCKDLDMTSATLQTQIANIIKEQLKDLENIAATEIMSDLHVIINLTCNLQDRFFEDNFQWNLNDKSLTPERFATSIVQDLGLTREFIPLISQSLHETILKIKKDWVDGHLIQDHVPNDAAFGYLSGIRLDIDELGSNWCPRVEILTKEEIQKREIEKERNLRRLKRETDRLSRRGRRRLDDLETTMRM

Entity 12 Entity 12 polymer

Description description	Nuclear protein STH1/NPS1
Molecular weight formula_weight	156982.4 kDa
EC 编号 ec_number	3.6.4.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MLQEQSELMSTVMNNTPTTVAALAAVAAASETNGKLGSEEQPEITIPKPRSSAQLEQLLYRYRAIQNHPKENKLEIKAIEDTFRNISRDQDIYETKLDTLRKSIDKGFQYDEDLLNKHLVALQLLEKDTDVPDYFLDLPDTKNDNTTAIEVDYSEKKPIKISADFNAKAKSLGLESKFSNATKTALGDPDTEIRISARISNRINELERLPANLGTYSLDDCLEFITKDDLSSRMDTFKIKALVELKSLKLLTKQKSIRQKLINNVASQAHHNIPYLRDSPFTAAAQRSVQIRSKVIVPQTVRLAEELERQQLLEKRKKERNLHLQKINSIIDFIKERQSEQWSRQERCFQFGRLGASLHNQMEKDEQKRIERTAKQRLAALKSNDEEAYLKLLDQTKDTRITQLLRQTNSFLDSLSEAVRAQQNEAKILHGEEVQPITDEEREKTDYYEVAHRIKEKIDKQPSILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKKDIGPFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRHSLQHQIRVGNFDVLLTTYEYIIKDKSLLSKHDWAHMIIDEGHRMKNAQSKLSFTISHYYRTRNRLILTGTPLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFLLRRLKKEVEKDLPDKVEKVIKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIMQLRKICNHPFVFDEVEGVVNPSRGNSDLLFRVAGKFELLDRVLPKFKASGHRVLMFFQMTQVMDIMEDFLRMKDLKYMRLDGSTKTEERTEMLNAFNAPDSDYFCFLLSTRAGGLGLNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESETNRDDDDKAELDDDELNDTLARSADEKILFDKIDKERMNQERADAKAQGLRVPPPRLIQLDELPKVFREDIEEHFKKEDSEPLGRIRQKKRVYYDDGLTEEQFLEAVEDDNMSLEDAIKKRREARERRRLRQNGTKENEIETLENTPEASETSLIENNSFTAAVDEETNADKETTASRSKRRSSRKKRTISIVTAEDKENTQEESTSQENGGAKVEEEVKSSSVEIINGSESKKKKPKLTVKIKLNKTTVLENNDGKRAEEKPESKSPAKKTAAKKTKTKSKSLGIFPTVEKLVEEMREQLDEVDSHPRTSIFEKLPSKRDYPDYFKVIEKPMAIDIILKNCKNGTYKTLEEVRQALQTMFENARFYNEEGSWVYVDADKLNEFTDEWFKEHSS

Entity 13 Entity 13 polymer

Description description	Chromatin structure-remodeling complex protein RSC30
Molecular weight formula_weight	101448.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MMDMQVRKVRKPPACTQCRKRKIGCDRAKPICGNCVKYNKPDCFYPDGPGKMVAVPSASGMSTHGNGQGSNHFSQGNGVNQKNVMIQTQYPIMQTSIEAFNFSFNPSVDTAMQWTKAASYQNNNTNNNTAPRQNSSTVSSNVHGNTIVRSDSPDVPSMDQIREYNTRLQLVNAQSFDYTDNPYSFNVGINQDSAVFDLMTSPFTQEEVLIKEIDFLKNKLLDLQSLQLKSLKEKSNLNADNTTANKINKTGENSKKGKVDGKRAGFDHQTSRTSQSSQKYFTALTITDVQSLVQVKPLKDTPNYLFTKNFIIFRDHYLFKFYNILHDICHINQFKVSPPNNKNHQQYMEVCKVNFPPKAIIIETLNSESLNNLNIEEFLPIFDKTLLLEFVHNSFPNGDTCPSFSTVDLPLSQLTKLGELTVLLLLLNDSMTLFNKQAINNHVSALMNNLRLIRSQITLINLEYYDQETIKFIAITKFYESLYMHDDHKSSLDEDLSCLLSFQIKDFKLFHFLKKMYYSRHSLLGQSSFMVPAAENLSPIPASIDTNDIPLIANDLKLLETQAKLINILQGVPFYLPVNLTKIESLLETLTMGVSNTVDLYFHDNEVRKEWKDTLNFINTIVYTNFFLFVQNESSLSMAVQHSSNNNKTSNSERCAKDLMKIISNMHIFYSITFNFIFPIKSIKSFSSGNNRFHSNGKEFLFANHFIEILQNFIAITFAIFQRCEVILYDEFYKNLSNEEINVQLLLIHDKILEILKKIEIIVSFLRDEMNSNGSFKSIKGFNKVLNLIKYMLRFSKKKQNFARNSDNNNVTDYSQSAKNKNVLLKFPVSELNRIYLKFKEISDFLMEREVVQRSIIIDKDLESDNLGITTANFNDFYDAFYN

Entity 14 Entity 14 polymer

Description description	Unknown protein
Molecular weight formula_weight	2401.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

XXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 15 Entity 15 polymer

Description description	Unknown Protein
Molecular weight formula_weight	1635.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,4

XXXXXXXXXXXXXXXXXXX

Entity 16 Entity 16 polymer

Description description	Unknown protein
Molecular weight formula_weight	1209.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5

XXXXXXXXXXXXXX

Entity 17 Entity 17 polymer

Description description	Unknown Protein
Molecular weight formula_weight	1294.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	6

XXXXXXXXXXXXXXX

Entity 18 Entity 18 polymer

Description description	Unknown Protein
Molecular weight formula_weight	4188.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	7

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 19 Entity 19 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.07 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	1920066

RSC core

1. Protein Identity and Related Structures Protein Identity & Related Structures

High temperature lethal protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit RSC7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit RSC2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit RSC4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex subunit RSC9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chromatin structure-remodeling complex protein RSC58

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer