SAXSdb — 6vhr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

PE family immunomodulator PE5

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	PPE family protein PPE4 × 1 （P9WI43） ESX-3 secretion-associated protein EspG3 × 1 （B2HNX0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PE05_MYCTU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–100； UniProt 6–102

PPE family protein PPE4

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

UniProt P9WI43

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	PE family immunomodulator PE5 × 1 （L7N695） ESX-3 secretion-associated protein EspG3 × 1 （B2HNX0）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PPE04_MYCTU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–178； UniProt 1–178

ESX-3 secretion-associated protein EspG3

Mycobacterium marinum (strain ATCC BAA-535 / M)

UniProt B2HNX0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	PE family immunomodulator PE5 × 1 （L7N695） PPE family protein PPE4 × 1 （P9WI43）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2HNX0_MYCMM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 3–288； UniProt 5–290

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6vhr
Deposition date deposition_date	2020-01-10
Structure title title	Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group I422
Keywords keywords	chaperone, protein secretion, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6vhr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6vhr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6vhr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.00 Å
Rg (electron density)	34.79 Å
Total Rg	34.63 Å
Atom count	7206
Residues	497
Excluded volume	64751 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6vhr__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	PE family immunomodulator PE5
Molecular weight formula_weight	9228.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	7206

GAMVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQTAAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVVGG

Source Source

Source organism organism	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
NCBI taxonomy ID ncbi_taxonomy_id	83332
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	PPE family protein PPE4
Molecular weight formula_weight	18099.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTAAELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTALAAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGAALASAPRTVPAPTVM

Source Source

Source organism organism	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
NCBI taxonomy ID ncbi_taxonomy_id	83332
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	ESX-3 secretion-associated protein EspG3
Molecular weight formula_weight	30875.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAPNAVELTVENAWFIAEMVGAGTFPWVLAITTPYSDEAQRSAFFARQRDELTQLGLLSSDGVVNPAVAEWIKVVCFPERWLDLRYVGPGTGNGGEDLLRGIVAQSAGIMGKAGKAHPSFNTVVALRNAQLVTFTAMDIDDPRALVPVLGVGLSARPPARFEEFSMPMRVGARADERLRSGESLDEVLDYLGIPVSARPVVQAVFSGPRSYVEIVAGCNRDGEHTTTDVGLSIVDTTAGRVLVSPSRAFDGEWVSTFSAGTPFATAVAIDQLIANLPDGQWFPGQRLS

Source Source

Source organism organism	Mycobacterium marinum (strain ATCC BAA-535 / M)
NCBI taxonomy ID ncbi_taxonomy_id	216594
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	219.090 Å
Unit-cell length b length_b	219.090 Å
Unit-cell length c length_c	104.430 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	I 4 2 2
Space-group number int_tables_number	97
Crystal system crystal_system	—

Resolution resolution	3.300 Å
Low-resolution limit resolution_low	35.727 Å
R factor r_factor	0.2485
R_work r_work	0.2476
R_free r_free	0.2662

Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group I422

1. Protein Identity and Related Structures Protein Identity & Related Structures

PE family immunomodulator PE5

State in the Current Structure

Other States of the Same Protein in the Database

PPE family protein PPE4

State in the Current Structure

Other States of the Same Protein in the Database

ESX-3 secretion-associated protein EspG3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6vhr__assembly_1__model_1

6vhr__assembly_1__model_1 | I(q)

6vhr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)

Structure of PE5-PPE4-EspG3 complex from the type VII (ESX-3) secretion system, space group I422

1. Protein Identity and Related Structures Protein Identity & Related Structures

PE family immunomodulator PE5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PPE family protein PPE4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ESX-3 secretion-associated protein EspG3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6vhr__assembly_1__model_1

6vhr__assembly_1__model_1 | I(q)

6vhr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (1)