6yp7

PSII-LHCII C2S2 supercomplex from Pisum sativum grown in high light conditions

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein 8, chloroplastic

Pisum sativum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB28_PEA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain G； PDBConstruct 1–219； UniProt 49–267 Author chain N； PDBConstruct 1–219； UniProt 49–267 Author chain Y； PDBConstruct 1–219； UniProt 49–267 Author chain g； PDBConstruct 1–219； UniProt 49–267 Author chain n； PDBConstruct 1–219； UniProt 49–267 Author chain y； PDBConstruct 1–219； UniProt 49–267

Photosystem II protein D1

Pisum sativum

UniProt P06585

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_PEA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–334； UniProt 11–344 Author chain a； PDBConstruct 1–334； UniProt 11–344

Photosystem II CP47 reaction center protein

Pisum sativum

UniProt Q9XQR6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9XQR6_PEA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–503； UniProt 2–504 Author chain b； PDBConstruct 1–503； UniProt 2–504

Photosystem II CP43 reaction center protein

Pisum sativum

UniProt P06004

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_PEA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–450； UniProt 24–473 Author chain c； PDBConstruct 1–450； UniProt 24–473

Photosystem II D2 protein

Pisum sativum

UniProt P06006

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_PEA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–341； UniProt 13–353 Author chain d； PDBConstruct 1–341； UniProt 13–353

Cytochrome b559 subunit alpha

Pisum sativum

UniProt P13554

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_PEA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–75； UniProt 8–82 Author chain e； PDBConstruct 1–75； UniProt 8–82

Cytochrome b559 subunit beta

Pisum sativum

UniProt P62096

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_PEA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain F； PDBConstruct 1–30； UniProt 10–39 Author chain f； PDBConstruct 1–30； UniProt 10–39

Photosystem II reaction center protein H

Pisum sativum

UniProt Q9XQR3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_PEA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–60； UniProt 13–72 Author chain h； PDBConstruct 1–60； UniProt 13–72

Photosystem II reaction center protein I

Pisum sativum

UniProt D5MAJ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5MAJ9_PEA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–34； UniProt 1–34 Author chain i； PDBConstruct 1–34； UniProt 1–34

Photosystem II reaction center protein J

Pisum sativum

UniProt P13555

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBJ_PEA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–35； UniProt 6–40 Author chain j； PDBConstruct 1–35； UniProt 6–40

Photosystem II reaction center protein K

Pisum sativum

UniProt D5MAJ8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D5MAJ8_PEA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–37； UniProt 25–61 Author chain k； PDBConstruct 1–37； UniProt 25–61

Photosystem II reaction center protein L

Pisum sativum

UniProt P60147

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_PEA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–37； UniProt 2–38 Author chain l； PDBConstruct 1–37； UniProt 2–38

Photosystem II reaction center protein M

Pisum sativum

UniProt P69529

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_PEA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–33； UniProt 1–33 Author chain m； PDBConstruct 1–33； UniProt 1–33

Oxygen-evolving enhancer protein 1, chloroplastic

Pisum sativum

UniProt P14226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO_PEA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain O； PDBConstruct 1–248； UniProt 82–329 Author chain o； PDBConstruct 1–248； UniProt 82–329

Photosystem II reaction center protein T

Pisum sativum

UniProt Q8HS25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_PEA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain T； PDBConstruct 1–32； UniProt 1–32 Author chain t； PDBConstruct 1–32； UniProt 1–32

Photosystem II reaction center protein W

Pisum sativum

UniProt A0A2D0TCJ2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2D0TCJ2_PEA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain W； PDBConstruct 1–54； UniProt 1–54 Author chain w； PDBConstruct 1–54； UniProt 1–54

Ultraviolet-B-repressible protein

Pisum sativum

UniProt Q8VYY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Photosystem II reaction center protein Z × 2 （Q32902） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8VYY1_PEA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain X； PDBConstruct 1–39； UniProt 45–83 Author chain x； PDBConstruct 1–39； UniProt 45–83

Photosystem II reaction center protein Z

Pisum sativum

UniProt Q32902

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Chlorophyll a-b binding protein 8, chloroplastic × 6 （P27490） Photosystem II protein D1 × 2 （P06585） Photosystem II CP47 reaction center protein × 2 （Q9XQR6） Photosystem II CP43 reaction center protein × 2 （P06004） Photosystem II D2 protein × 2 （P06006） Cytochrome b559 subunit alpha × 2 （P13554） Cytochrome b559 subunit beta × 2 （P62096） Photosystem II reaction center protein H × 2 （Q9XQR3） Photosystem II reaction center protein I × 2 （D5MAJ9） Photosystem II reaction center protein J × 2 （P13555） Photosystem II reaction center protein K × 2 （D5MAJ8） Photosystem II reaction center protein L × 2 （P60147） Photosystem II reaction center protein M × 2 （P69529） Oxygen-evolving enhancer protein 1, chloroplastic × 2 （P14226） Photosystem II reaction center protein T × 2 （Q8HS25） Photosystem II reaction center protein W × 2 （A0A2D0TCJ2） Ultraviolet-B-repressible protein × 2 （Q8VYY1） Light harvesting chlorophyll a/b-binding protein Lhcb4.3 × 2 Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26 × 2 CHLOROPHYLL B × 48 CHLOROPHYLL A × 150 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 12 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 8 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 7 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 26 CA-MN4-O5 CLUSTER × 2 FE (II) ION × 2 CHLORIDE ION × 4 PHEOPHYTIN A × 4 BETA-CAROTENE × 22 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 4 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 8 BICARBONATE ION × 2 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 10 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 14 PROTOPORPHYRIN IX CONTAINING FE × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_PEA
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6yp7
Deposition date deposition_date	2020-04-15
Structure title title	PSII-LHCII C2S2 supercomplex from Pisum sativum grown in high light conditions
Keywords keywords	Cryo-EM, photosystem II, High Light, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6yp7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6yp7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6yp7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	76.80 Å
Rg (electron density)	77.83 Å
Total Rg	77.26 Å
Atom count	71784
Residues	7002
Excluded volume	1338700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6yp7__assembly_1__model_1`	44-meric （44）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (37)

Entity 1 Entity 1 polymer

Description description	Chlorophyll a-b binding protein 8, chloroplastic
Molecular weight formula_weight	23573.5 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,n,y,G,N,Y
Atom count atom_count	71784

GSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPG

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 2 Entity 2 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	36972.1 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,A

ENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 3 Entity 3 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	55659.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,B

GLPWYRVHTVVLNDPGRLLSVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWNITGGTITNPGIWSYEGVAAAHIVFSGLCFLAAIWHWLYWDLEIFCDERTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLFGPGIWVSDPYGLTGRVQSVNPAWGVDGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGHVENQSLSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMPTFFETFPVVLVDGDGIVRGDVPFRRAESKYSVEQVGVIVEFYGGELNGVTYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDLFAGIDPDLDAQVEFGAFQKLGDPTTR

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 4 Entity 4 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	49275.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,C

TGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGSFLLVFKAFYFGGIYDTWAPGGGDVRKITNFTLSPSILFGYLLKSPFGGEGWIVSVDDLEDIIGGHVWLGSICILGGIWHILTKPFAWARRALVWSGEAYLSYSLGALAVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 5 Entity 5 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	38220.6 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,D

NDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFAVGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDLTRWCQLGGLWTFVALHGAFGLIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMATQDQPHENLIFPEEVLPRGNAL

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 6 Entity 6 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	8624.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,E

RSFADIITSIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTETRQGIPLITGRFDSLEQLDEFSRS

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 7 Entity 7 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	3396.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,F

FTVRWLAVHGLAVPTVFFLGSISAMQFIQR

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	6455.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h,H

GPRRTAVGDLLKPLNSEYGKVAPGWGTTPLMGIAMALFAVFLSIILEIYNSSLLLDQISM

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 9 Entity 9 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	3926.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i,I

MLTLKLFVYTIVIFFVSLFIFGFLSNDPGRNPGR

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein J
Molecular weight formula_weight	3598.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j,J

GRIPLWIIGTVAGIVVIGLIGLFFYGSYSGLGSSL

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 11 Entity 11 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	4287.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k,K

KLPEAYAFLNPIVDFMPVIPLLFFLLAFVWQAAVSFR

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 12 Entity 12 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4366.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l,L

TQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 13 Entity 13 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3641.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m,M

MEVNILAFIATALFILVPTAFLLIIYVKTVSQS

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 14 Entity 14 polymer

Description description	Oxygen-evolving enhancer protein 1, chloroplastic
Molecular weight formula_weight	26554.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o,O

EGAPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGVDSFSFKPGKYNAKKLCLEPTSFTVKSEGVTKNTPLAFQNTKLMTRLTYTLDEIEGPFEVSADGSVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLES

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 15 Entity 15 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3692.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t,T

MEALVYTFLLVSTLGIIFFAIFFREPPKVPTK

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 16 Entity 16 polymer

Description description	Photosystem II reaction center protein W
Molecular weight formula_weight	5914.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w,W

LVDDRMSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFIYASGLDEDEESGLSL

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 17 Entity 17 polymer

Description description	Ultraviolet-B-repressible protein
Molecular weight formula_weight	3929.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x,X

ATVSPSLKNFLLSIVSGGVVVTAILGAVIGVSNFDPVKR

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 18 Entity 18 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6555.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z,Z

MTIAFQLAVFALIVTSSILLISVPVVFASPDGWSSNKNVVFSGTSLWIGLVFLVGILNSLIS

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 19 Entity 19 polymer

Description description	Light harvesting chlorophyll a/b-binding protein Lhcb4.3
Molecular weight formula_weight	24460.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r,R

GLVWFPGAQPPEWLDGTMIGDRGFDPLGFAKPAEYLQFDLDSLDQNLAKNLAGDVIGTRVEAGEVKPTPFQPYSEVFGIERFRECELIHGRWAMLGALGALAVEAFTGVAWQDAGKVELVEGASYFGFSLPFSLTALIWIEVLVIGYIEFQRNAELDPEKRLYPGGKFFDPLGLANDPEEKERLQLAEIKHSRLAMVVFLVFAIQAAVSGKGPIGFIATFNQ

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 20 Entity 20 polymer

Description description	Light harvesting chlorophyll a/b-binding protein Lhcb5, CP26
Molecular weight formula_weight	23839.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s,S

ANEELAKWYGPDRRIFLPDGLLDRSEIPEYLTGEVPGDYGYDPFGLSKKPEDFAKYQGYELIHARWAMLGAAGFIIPEAFNKYGANCGPEAVWFKTGALLLDGGTLNYFGKPIPINLILAVVAEVVLLGGAEYYRITNGLDLEDKFHPGGPFDPLGLANDPDQAAILKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENFAKHLSDPFGNNLLTVIAG

Source Source

Source organism organism	Pisum sativum
Common name common_name	Pea
NCBI taxonomy ID ncbi_taxonomy_id	3888
Host organism host_organism	Pisum sativum

Entity 21 Entity 21 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	48

Entity 22 Entity 22 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	150

Entity 23 Entity 23 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 24 Entity 24 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 25 Entity 25 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 26 Entity 26 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	26

Entity 27 Entity 27 non-polymer

Description description	CA-MN4-O5 CLUSTER
Molecular weight formula_weight	339.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 29 Entity 29 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 30 Entity 30 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 31 Entity 31 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 32 Entity 32 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 33 Entity 33 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 34 Entity 34 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 35 Entity 35 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 36 Entity 36 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 37 Entity 37 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

Domain ID domain_id	6yp7A01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	6yp7G01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yp7N01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yp7S01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yp7Y01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yp7a01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	85 — Photosynthetic Reaction Center, subunit M; domain 1
Homologous superfamily homologous superfamily	10 — Photosystem II protein D1-like

Domain ID domain_id	6yp7g01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yp7n01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yp7s01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

Domain ID domain_id	6yp7y01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	3460 — Chlorophyll a-b binding protein
Homologous superfamily homologous superfamily	10 — Chlorophyll a/b binding protein domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	27942

PSII-LHCII C2S2 supercomplex from Pisum sativum grown in high light conditions

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chlorophyll a-b binding protein 8, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP47 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II CP43 reaction center protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II D2 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b559 subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein J

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer