6z80

stimulatory human GTP cyclohydrolase I - GFRP complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	GTP cyclohydrolase 1 feedback regulatory protein × 10 （P30047） ZINC ION × 10 PHENYLALANINE × 10 8-OXO-GUANOSINE-5'-TRIPHOSPHATE × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GCH1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 15–224； UniProt 41–250 Author chain B； PDBConstruct 15–224； UniProt 41–250 Author chain C； PDBConstruct 15–224； UniProt 41–250 Author chain D； PDBConstruct 15–224； UniProt 41–250 Author chain E； PDBConstruct 15–224； UniProt 41–250 Author chain F； PDBConstruct 15–224； UniProt 41–250 Author chain G； PDBConstruct 15–224； UniProt 41–250 Author chain H； PDBConstruct 15–224； UniProt 41–250 Author chain I； PDBConstruct 15–224； UniProt 41–250 Author chain J； PDBConstruct 15–224； UniProt 41–250

GTP cyclohydrolase 1 feedback regulatory protein

Homo sapiens

UniProt P30047

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	GTP cyclohydrolase 1 × 10 （P30793） ZINC ION × 10 PHENYLALANINE × 10 8-OXO-GUANOSINE-5'-TRIPHOSPHATE × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GFRP_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain K； PDBConstruct 4–87； UniProt 1–84 Author chain L； PDBConstruct 4–87； UniProt 1–84 Author chain M； PDBConstruct 4–87； UniProt 1–84 Author chain N； PDBConstruct 4–87； UniProt 1–84 Author chain O； PDBConstruct 4–87； UniProt 1–84 Author chain P； PDBConstruct 4–87； UniProt 1–84 Author chain Q； PDBConstruct 4–87； UniProt 1–84 Author chain R； PDBConstruct 4–87； UniProt 1–84 Author chain S； PDBConstruct 4–87； UniProt 1–84 Author chain T； PDBConstruct 4–87； UniProt 1–84

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6z80
Deposition date deposition_date	2020-06-02
Structure title title	stimulatory human GTP cyclohydrolase I - GFRP complex
Keywords keywords	;GTP cyclohydrolase GFTP, I, EC:3.5.4.16, Tetrahydrobiopterin (BH4) synthesis, Cytosol, Zinc Ion Binding, Hydrolase Activity, Metal Ion Binding, Nucleotide Binding, allosteric enzyme, substrate analogue bound, HYDROLASE ;; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6z80__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6z80__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6z80__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.00 Å
Rg (electron density)	42.42 Å
Total Rg	42.58 Å
Atom count	21460
Residues	2650
Excluded volume	383980 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6z80__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	GTP cyclohydrolase 1
Molecular weight formula_weight	25324.9 kDa
EC 编号 ec_number	3.5.4.16
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,E,G,H,I,J,F,D
Atom count atom_count	21460

MHHHHHHGSDDDDKRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	GTP cyclohydrolase 1 feedback regulatory protein
Molecular weight formula_weight	9992.5 kDa
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,K,N,M,O,P,Q,R,S,T

GSHMPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 4 Entity 4 non-polymer

Description description	PHENYLALANINE
Molecular weight formula_weight	165.2 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 5 Entity 5 non-polymer

Description description	8-OXO-GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	539.2 kDa
Source method src_method	syn
Copy count entity_count	10

▼

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (20 domains)

Domain ID domain_id	d6z80a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80d_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80e_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80f_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80g_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80h_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80i_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80j_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.96 — T-fold
Superfamily Superfamily superfamily	d.96.1 — Tetrahydrobiopterin biosynthesis enzymes-like
Family Family family	d.96.1.1 — GTP cyclohydrolase I

Domain ID domain_id	d6z80k_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80l_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80m_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80n_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80o_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80p_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80q_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80r_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80s_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

Domain ID domain_id	d6z80t_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.205 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Superfamily Superfamily superfamily	d.205.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP
Family Family family	d.205.1.1 — GTP cyclohydrolase I feedback regulatory protein, GFRP

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	122310

stimulatory human GTP cyclohydrolase I - GFRP complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase 1

State in the Current Structure

Other States of the Same Protein in the Database

GTP cyclohydrolase 1 feedback regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6z80__assembly_1__model_1

6z80__assembly_1__model_1 | I(q)

6z80__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (20 domains)

7. Citations (1)

stimulatory human GTP cyclohydrolase I - GFRP complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

GTP cyclohydrolase 1 feedback regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6z80__assembly_1__model_1

6z80__assembly_1__model_1 | I(q)

6z80__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 20 domains

SCOP 2.08 (20 domains)

7. Citations (1)