SAXSdb — 7alc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	GTP cyclohydrolase 1 feedback regulatory protein × 10 （P30047） ZINC ION × 10 PHENYLALANINE × 10 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GCH1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–209； UniProt 42–250 Author chain B； PDBConstruct 1–209； UniProt 42–250 Author chain C； PDBConstruct 1–209； UniProt 42–250 Author chain D； PDBConstruct 1–209； UniProt 42–250 Author chain E； PDBConstruct 1–209； UniProt 42–250

GTP cyclohydrolase 1 feedback regulatory protein

OrganismNot specified

UniProt P30047

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 20	GTP cyclohydrolase 1 × 10 （P30793） ZINC ION × 10 PHENYLALANINE × 10 water × 20	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GFRP_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 4–87； UniProt 1–84 Author chain G； PDBConstruct 4–87； UniProt 1–84 Author chain H； PDBConstruct 4–87； UniProt 1–84 Author chain I； PDBConstruct 4–87； UniProt 1–84 Author chain J； PDBConstruct 4–87； UniProt 1–84

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7alc
Deposition date deposition_date	2020-10-06
Structure title title	human GCH-GFRP stimulatory complex
Keywords keywords	;GTP cyclohydrolase 1, GTPCH1, GTP cyclohydrolase I regulatory protein, GFRP, allosteric regulation, complex, allosteric regulator, HYDROLASE ;; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7alc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7alc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7alc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.06 Å
Rg (electron density)	42.29 Å
Total Rg	42.49 Å
Atom count	20584
Residues	2564
Excluded volume	367320 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7alc__assembly_1__model_1`	eicosameric （20）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	GTP cyclohydrolase 1
Molecular weight formula_weight	23474.0 kDa
EC 编号 ec_number	3.5.4.16
Source method src_method	man
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E
Atom count atom_count	11273

PEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	GTP cyclohydrolase 1 feedback regulatory protein
Molecular weight formula_weight	9992.5 kDa
Source method src_method	syn
Copy count entity_count	5

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G,H,I,J

GSHMPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 4 Entity 4 non-polymer

Description description	PHENYLALANINE
Molecular weight formula_weight	165.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	979

▶

Unit-cell length a length_a	163.853 Å
Unit-cell length b length_b	113.922 Å
Unit-cell length c length_c	113.910 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	130.21 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	20

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.726 Å
Low-resolution limit resolution_low	86.990 Å
R factor r_factor	0.1979
R_work r_work	0.1970
R_free r_free	0.2273

human GCH-GFRP stimulatory complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase 1

State in the Current Structure

Other States of the Same Protein in the Database

GTP cyclohydrolase 1 feedback regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7alc__assembly_1__model_1

7alc__assembly_1__model_1 | I(q)

7alc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

human GCH-GFRP stimulatory complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

GTP cyclohydrolase 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

GTP cyclohydrolase 1 feedback regulatory protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7alc__assembly_1__model_1

7alc__assembly_1__model_1 | I(q)

7alc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)