SAXSdb — 7b56

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium/calmodulin-dependent protein kinase type II subunit alpha

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–315	Not recorded	Alpha-actinin-2 × 1 （P35609） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M MES pH 6.0, 20% w/v PEG4000, 0.2 M Lithium Sulfate	Resolution 1.45 Å R-free 0.215

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7B56	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1HKX Crystal structure of calcium/calmodulin-dependent protein kinase Deposited 2003-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 14 PDB declaration: tetradecameric	Chain A 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain B 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain C 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain D 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain E 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain F 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain G 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain H 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain I 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain J 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain K 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain L 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain M 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478 Chain N 336–478（143 aa） Fragment：ASSOCIATION DOMAIN, RESIDUES 336-478	Not recorded	DTT 2,3-DIHYDROXY-1,4-DITHIOBUTANE × 1 CL CHLORIDE ION × 14 TBR HEXATANTALUM DODECABROMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.8；pH 4.80	Resolution 2.65 Å R-free 0.279
7B55 Crystal structure of CaMKII-actinin complex bound to MES Deposited 2020-12-03	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–315（315 aa）	Not recorded	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M MES pH 6.0, 20% w/v PEG4000, 0.2 M Lithium Sulfate	Resolution 1.60 Å R-free 0.214
7B57 Crystal structure of CaMKII-actinin complex bound to ADP Deposited 2020-12-03	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–315（315 aa）	Not recorded	MG MAGNESIUM ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M MES pH 6.0, 20% w/v PEG4000, 0.2 M Lithium Sulfate	Resolution 1.95 Å R-free 0.247

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KCC2A_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 3–317； UniProt 1–315

Alpha-actinin-2

Homo sapiens

UniProt P35609

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 825–894	Not recorded	Calcium/calmodulin-dependent protein kinase type II subunit alpha × 1 （P11798） ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 MG MAGNESIUM ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M MES pH 6.0, 20% w/v PEG4000, 0.2 M Lithium Sulfate	Resolution 1.45 Å R-free 0.215

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7B56	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1H8B EF-hands 3,4 from alpha-actinin / Z-repeat 7 from titin Deposited 2001-02-01	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 822–894（73 aa） Fragment：EF-HANDS 3&4 RESIDUE 822-894	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.6；300 K；Ionic strength (raw mmCIF value) 20；Pressure 1 NMR sample composition 0.7 MM COMPLEX	Resolution not provided
1HCI CRYSTAL STRUCTURE OF THE ROD DOMAIN OF ALPHA-ACTININ Deposited 2001-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 274–746（473 aa） Fragment：SPECTRIN-LIKE REPEATS 1,2,3, AND 4 - AMINO ACIDS 274 - 746 Chain B 274–746（473 aa） Fragment：SPECTRIN-LIKE REPEATS 1,2,3, AND 4 - AMINO ACIDS 274 - 746	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 8.5；0.9 M (NH4)2SO4, 0.1 M TRISHCL PH 8.5	Resolution 2.80 Å R-free 0.295
1QUU CRYSTAL STRUCTURE OF TWO CENTRAL SPECTRIN-LIKE REPEATS FROM ALPHA-ACTININ Deposited 1999-07-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 391–637（247 aa） Fragment：SPECTRIN-LIKE REPEATS 2 AND 3 - AMINO ACIDS 391 TO 637	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；26% PEG 400 (FLUKA), 100 MM MGSO4, 100 MM HEPES OR TRIS-HCL, pH 7.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.50 Å R-free 0.310
4D1E THE CRYSTAL STRUCTURE OF HUMAN MUSCLE ALPHA-ACTININ-2 Deposited 2014-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 19–894（876 aa） Fragment：RESIDUES 19-894	Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions 0.2 M MG FORMATE 5% PEG SMEAR, 0.01 M EDTA	Resolution 3.50 Å R-free 0.258
5A36 Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–266（248 aa） Fragment：CALPONIN HOMOLOGY DOMAIN, UNP RESIDUES 19-266	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；30% POLYETHYLENE GLYCOL 1500, pH 7.5	Resolution 2.00 Å R-free 0.269
5A36 Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 19–266（248 aa） Fragment：CALPONIN HOMOLOGY DOMAIN, UNP RESIDUES 19-266	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；30% POLYETHYLENE GLYCOL 1500, pH 7.5	Resolution 2.00 Å R-free 0.269
5A37 Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Deposited 2015-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–266（248 aa） Fragment：CALPONIN HOMOLOGY DOMAIN	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；28% POLYETHYLENE GLYCOL 2000, pH 7.5	Resolution 1.88 Å R-free 0.216
5A37 Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Deposited 2015-05-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 19–266（248 aa） Fragment：CALPONIN HOMOLOGY DOMAIN	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；28% POLYETHYLENE GLYCOL 2000, pH 7.5	Resolution 1.88 Å R-free 0.216
5A38 Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–266（248 aa） Fragment：CALPONIN HOMOLOGY DOMAIN, RESIDUES 19 TO 266	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；22% POLYETHYLENE GLYCOL 3350, pH 7.5	Resolution 1.90 Å R-free 0.231
5A38 Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Deposited 2015-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 19–266（248 aa） Fragment：CALPONIN HOMOLOGY DOMAIN, RESIDUES 19 TO 266	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；22% POLYETHYLENE GLYCOL 3350, pH 7.5	Resolution 1.90 Å R-free 0.231
5A4B Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Deposited 2015-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 19–266（248 aa） Fragment：CALPONIN HOMOLOGY DOMAIN, RESIDUES 19-266	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；24% POLYETHYLENE GLYCOL 3350, pH 7.5	Resolution 2.01 Å R-free 0.235
5A4B Mutations in the Calponin homology domain of Alpha-Actinin-2 affect Actin binding and incorporation in muscle. Deposited 2015-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 19–266（248 aa） Fragment：CALPONIN HOMOLOGY DOMAIN, RESIDUES 19-266	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；24% POLYETHYLENE GLYCOL 3350, pH 7.5	Resolution 2.01 Å R-free 0.235
6SWT Affimer9 co-crystalised with the CH domains of alpha actinin 2. Deposited 2019-09-23	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 19–270（252 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；20% PEG 3350, 0.2M ammonium tartrate	Resolution 1.20 Å R-free 0.164
6TS3 EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment Deposited 2019-12-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 825–894（70 aa）	Not recorded	ACE ACETYL GROUP × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M BIS-TRIS pH 6.5, 25% w/v Polyethylene glycol 3,350	Resolution 1.28 Å R-free 0.199
6TS3 EF-hands 3 and 4 of alpha-actinin in complex with CaMKII regulatory segment Deposited 2019-12-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 825–894（70 aa）	Not recorded	ACE ACETYL GROUP × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M BIS-TRIS pH 6.5, 25% w/v Polyethylene glycol 3,350	Resolution 1.28 Å R-free 0.199
7A8T Crystal structure of sarcomeric protein FATZ-1 (mini-FATZ-1 construct) in complex with rod domain of alpha-actinin-2 Deposited 2020-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 274–746（473 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；100 mM HEPES (pH 7.0), 16% w/v Jeffamine ED-2003	Resolution 2.69 Å R-free 0.235
7A8U Crystal structure of sarcomeric protein FATZ-1 (d91-FATZ-1 construct) in complex with rod domain of alpha-actinin-2 Deposited 2020-08-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 274–746（473 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；295 K；100 mM Tris-HCl (pH 8.5), 200 mM trimethylamine N-oxide, 20% w/v polyethylene glycol 2,000 methyl ether	Resolution 3.80 Å R-free 0.239
7ANK Crystal structure of sarcomeric protein FATZ-1 (d91-FATZ-1 construct) in complex with half dimer of alpha-actinin-2 Deposited 2020-10-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–507（507 aa） Chain B 509–894（386 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；100 mM Bis-Tris propane (pH 7.5), 100 mM sodium citrate, 10 mM zinc chloride, 12% w/w polyethylene glycol 3,350	Resolution 3.20 Å R-free 0.284
7B55 Crystal structure of CaMKII-actinin complex bound to MES Deposited 2020-12-03	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 825–894（70 aa）	Not recorded	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M MES pH 6.0, 20% w/v PEG4000, 0.2 M Lithium Sulfate	Resolution 1.60 Å R-free 0.214
7B57 Crystal structure of CaMKII-actinin complex bound to ADP Deposited 2020-12-03	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 825–894（70 aa）	Not recorded	MG MAGNESIUM ION × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 ADP ADENOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.1 M MES pH 6.0, 20% w/v PEG4000, 0.2 M Lithium Sulfate	Resolution 1.95 Å R-free 0.247

15 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACTN2_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 4–73； UniProt 825–894

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7b56
Deposition date deposition_date	2020-12-03
Structure title title	Crystal structure of CaMKII-actinin complex bound to AMPPNP
Keywords keywords	CaMKII, actinin, dendritic spine, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	22.27 Å
Radius of gyration Rg (electron density) rg_electron	21.33 Å
Forward intensity I(0) i0	29687400.00
Molecular weight molecular_weight	41835.0 kDa
Excluded volume excluded_volume	52374 Å³
Envelope volume envelope_volume	60807 Å³
Hydration-shell volume shell_volume	23784 Å³
Envelope diameter envelope_diameter	72.2 Å
Shell Rg shell_rg	28.07 Å
Envelope Rg envelope_rg	21.41 Å
Shape Rg shape_rg	21.33 Å
Total Rg total_rg	22.15 Å
Total atoms total_atoms	2944
Residues n_residues	371
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	69.1 Å
Rg (real space) rg_real	22.16 Å
Rg uncertainty (real space) rg_real_error	0.31 Å
I(0) (real space) i0_real	2.9690e+07
I(0) uncertainty (real space) i0_real_error	3.3290e+05
Rg (reciprocal space) rg_reciprocal	22.19 Å
I(0) (reciprocal space) i0_reciprocal	29690000.0000
Solution quality estimate total_estimate	0.9080
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	28.2 Å
Skewness Skewness skewness	0.149
Kurtosis Kurtosis kurtosis	-0.513
Angular range angular_range	— – 0.3550 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	6513000.0000
Real-space data points n_real_points	67
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.938; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.994; Smooth: 0.992

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Calcium/calmodulin-dependent protein kinase type II subunit alpha
Molecular weight formula_weight	35903.4 kDa
EC 编号 ec_number	2.7.11.17
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	3416

SMMATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQILEAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTVTPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLKGAILAAMLATRNFSG

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	Mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Alpha-actinin-2
Molecular weight formula_weight	7903.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

SNATDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYAAFSSALYGESDL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER
Molecular weight formula_weight	506.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
Molecular weight formula_weight	195.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	441

▶

8. Citations (1)

▶

Unit-cell length a length_a	64.426 Å
Unit-cell length b length_b	72.510 Å
Unit-cell length c length_c	92.001 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	1.450 Å
Low-resolution limit resolution_low	52.770 Å
R factor r_factor	0.1908
R_work r_work	0.1901
R_free r_free	0.2154

fit	/app/data/saxs_computation/b5/7b56/7b56.fit
pddf	/app/data/pr_computation/b5/7b56/7b56.pr.out
profile	/app/data/saxs_computation/b5/7b56/7b56.dat

Crystal structure of CaMKII-actinin complex bound to AMPPNP

1. Protein Identity and Related Structures Protein Identity & Related Structures

Calcium/calmodulin-dependent protein kinase type II subunit alpha

State in the Current Structure

Other States of the Same Protein in the Database

Alpha-actinin-2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)