SAXSdb — 7bqz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spindlin-1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	H3(K4me3-K9me3) peptide × 1 （Q71DI3）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	H3(K4me3-K9me3) peptide × 1 （Q71DI3）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	H3(K4me3-K9me3) peptide × 1 （Q71DI3）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	H3(K4me3-K9me3) peptide × 1 （Q71DI3）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPIN1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–220； UniProt 45–262 Author chain C； PDBConstruct 3–220； UniProt 45–262 Author chain E； PDBConstruct 3–220； UniProt 45–262 Author chain G； PDBConstruct 3–220； UniProt 45–262

H3(K4me3-K9me3) peptide

OrganismNot specified

UniProt Q71DI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Spindlin-1 × 1 （Q9Y657）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Spindlin-1 × 1 （Q9Y657）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Spindlin-1 × 1 （Q9Y657）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Spindlin-1 × 1 （Q9Y657）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	H32_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–15； UniProt 2–16 Author chain D； PDBConstruct 1–15； UniProt 2–16 Author chain F； PDBConstruct 1–15； UniProt 2–16 Author chain H； PDBConstruct 1–15； UniProt 2–16

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bqz
Deposition date deposition_date	2020-03-26
Structure title title	Crystal Structure of Spindlin1 bound to H3(K4me3-K9me3) peptide
Keywords keywords	Spin/Ssty repeat, GENE REGULATION; GENE REGULATION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bqz__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bqz__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bqz__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.91 Å
Rg (electron density)	18.31 Å
Total Rg	19.44 Å
Atom count	1762
Residues	216
Excluded volume	31348 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bqz__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7bqz__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`7bqz__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`7bqz__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Spindlin-1
Molecular weight formula_weight	25058.2 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G
Atom count atom_count	7064

GSPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	H3(K4me3-K9me3) peptide
Molecular weight formula_weight	1650.0 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H

ARTKQTARKSTGGKA

▶

Unit-cell length a length_a	40.521 Å
Unit-cell length b length_b	142.681 Å
Unit-cell length c length_c	132.295 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.39 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.101 Å
Low-resolution limit resolution_low	48.390 Å
R factor r_factor	0.2260
R_work r_work	0.2240
R_free r_free	0.2639

Crystal Structure of Spindlin1 bound to H3(K4me3-K9me3) peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spindlin-1

State in the Current Structure

Other States of the Same Protein in the Database

H3(K4me3-K9me3) peptide

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bqz__assembly_2__model_1

7bqz__assembly_2__model_1 | I(q)

7bqz__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)

Crystal Structure of Spindlin1 bound to H3(K4me3-K9me3) peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spindlin-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

H3(K4me3-K9me3) peptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bqz__assembly_2__model_1

7bqz__assembly_2__model_1 | I(q)

7bqz__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

7. Citations (1)