SAXSdb — 7btr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Antirestriction protein ArdA

Enterococcus faecalis EnGen0302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Type I restriction enzyme R Protein × 1 （Q304R3） Type I restriction enzyme EcoR124II M protein × 2 （P10484） Type-1 restriction enzyme EcoR124II specificity protein × 1 （P10485）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0M2A928_ENTFL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–165； UniProt 1–165 Author chain F； PDBConstruct 1–165； UniProt 1–165

Type I restriction enzyme R Protein

Escherichia coli

UniProt Q304R3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Antirestriction protein ArdA × 2 （A0A0M2A928） Type I restriction enzyme EcoR124II M protein × 2 （P10484） Type-1 restriction enzyme EcoR124II specificity protein × 1 （P10485）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q304R3_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–1038； UniProt 1–1038

Type I restriction enzyme EcoR124II M protein

Escherichia coli

UniProt P10484

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Antirestriction protein ArdA × 2 （A0A0M2A928） Type I restriction enzyme R Protein × 1 （Q304R3） Type-1 restriction enzyme EcoR124II specificity protein × 1 （P10485）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T1M1_ECOLX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–520； UniProt 1–520 Author chain D； PDBConstruct 1–520； UniProt 1–520

Type-1 restriction enzyme EcoR124II specificity protein

Escherichia coli

UniProt P10485

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Antirestriction protein ArdA × 2 （A0A0M2A928） Type I restriction enzyme R Protein × 1 （Q304R3） Type I restriction enzyme EcoR124II M protein × 2 （P10484）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T1S1_ECOLX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–404； UniProt 1–404

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7btr
Deposition date deposition_date	2020-04-02
Structure title title	EcoR124I-ArdA in the Restriction-Alleviation State
Keywords keywords	Cryoelectron microscopy, Innate immune mechanism, Complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7btr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7btr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7btr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.19 Å
Rg (electron density)	43.79 Å
Total Rg	44.16 Å
Atom count	16737
Residues	2087
Excluded volume	297670 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7btr__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Antirestriction protein ArdA
Molecular weight formula_weight	19135.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F
Atom count atom_count	16737

MDDMQVYIANLGKYNEGELVGAWFTFPIDFEEVKEKIGLNDEYEEYAIHDYELPFTVDEYTSIGELNRLWEMVSELPEELQSELSALLTHFSSIEELSEHQEDIIIHSDCDDMYDVARYYIEETGALGEVPASLQNYIDYQAYGRDLDLSGTFISTNHGIFEIVY

Source Source

Source organism organism	Enterococcus faecalis EnGen0302
NCBI taxonomy ID ncbi_taxonomy_id	1158660
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Type I restriction enzyme R Protein
Molecular weight formula_weight	120278.9 kDa
EC 编号 ec_number	3.1.21.3
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MTHQTHTIAESNNFIVLDKYIKAEPTGDSYQSESDLERELIQDLRNQGYEFISVKSQSAMLANVREQLQNLNGVVFNDSEWRRFTEQYLDNPSDGILDKTRKIHIDYICDFIFDDERLENIYLIDKKNLMRNKVQIIQQFEQAGSHANRYDVTILVNGLPLVQIELKKRGVAIREAFNQIHRYSKESFNSENSLFKYLQLFVISNGTDTRYFANTTKRDKNSFDFTMNWAKSDNTLIKDLKDFTATCFQKHTLLNVLVNYSVFDSSQTLLVMRPYQIAATERILWKIKSSFTAKNWSKPESGGYIWHTTGSGKTLTSFKAARLATELDFIDKVFFVVDRKDLDYQTMKEYQRFSPDSVNGSENTAGLKRNLDKDDNKIIVTTIQKLNNLMKAESDLPVYNQQVVFIFDECHRSQFGEAQKNLKKKFKRYYQFGFTGTPIFPENALGSETTASVFGRELHSYVITDAIRDEKVLKFKVDYNDVRPQFKSLETETDEKKLSAAENQQAFLHPMRIQEITQYILNNFRQKTHRTFPGSKGFNAMLAVSSVDAAKAYYATFKRLQEEAANKSATYKPLRIATIFSFAANEEQNAIGEISDETFDTSAMDSSAKEFLDAAIREYNSHFKTNFSTDSNGFQNYYRDLAQRVKNQDIDLLIVVGMFLTGFDAPTLNTLFVDKNLRYHGLMQAFSRTNRIYDATKTFGNIVTFRDLERSTIDAITLFGDKNTKNVVLEKSYTEYMEGFTDAATGEAKRGFMTVVSELEQRFPDPTSIESEKEKKDFVKLFGEYLRAENILQNYDEFATLKALQQIDLSDPVAVEKFKAEHYVDDEKFAELQTIRLPADRKIQDYRSAYNDIRDWQRREKEAEKKEKSTTDWDDVVFEVDLLKSQEINLDYILGLIFEHNRQNKGKGEMIEEVKRLIRSSLGNRAKEGLVVDFIQQTNLDDLPDKASIIDAFFTFAQREQQREAEALIKEENLNEDAAKRYIRTSLKREYATENGTELNETLPKLSPLNPQYKTKKQAVFQKIVSFIEKFKGVGGKI

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Type I restriction enzyme EcoR124II M protein
Molecular weight formula_weight	58077.1 kDa
EC 编号 ec_number	2.1.1.72
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,A

MKMTSIQQRAELHRQIWQIANDVRGSVDGWDFKQYVLGALFYRFISENFSSYIEAGDDSICYAKLDDSVITDDIKDDAIKTKGYFIYPSQLFCNVAAKANTNDRLNADLNSIFVAIESSAYGYPSEADIKGLFADFDTTSNRLGNTVKDKNARLAAVLKGVEGLKLGDFNEHQIDLFGDAYEFLISNYAANAGKSGGEFFTPQHVSKLIAQLAMHGQTHVNKIYDPAAGSGSLLLQAKKQFDNHIIEEGFFGQEINHTTYNLARMNMFLHNINYDKFDIKLGNTLTEPHFRDEKPFDAIVSNPPYSVKWIGSDDPTLINDERFAPAGVLAPKSKADFAFVLHALNYLSAKGRAAIVCFPGIFYRGGAEQKIRQYLVDNNYVETVISLAPNLFFGTTIAVNILVLSKHKTDTNVQFIDASELFKKETNNNILTDAHIEQIMQVFASKEDVAHLAKSVAFETVVANDYNLSVSSYVEAKDNREIIDIAELNAELKTTVSKIDQLRKDIDAIVAEIEGCEVQK

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Type-1 restriction enzyme EcoR124II specificity protein
Molecular weight formula_weight	46235.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSEMSYLEKLLDGVEVEWLPLGEITKYEQPTKYLVKAKDYHDTYTIPVLTAGKTFILGYTNETHGIYQASKAPVIIFDDFTTANKWVDFDFKAKSSAMKMVTSCDDNKTLLKYVYYWLNTLPSEFAEGDHKRQWISNYSQKKIPIPCPDNPEKSLAIQSEIVRILDKFTALTAELTAELNMRKKQYNYYRDQLLSFKEGEVEWKTLGEIGKWYGGGTPSKNKIEFWENGSIPWISPKDMGRTLVDSSEDYITEEAVLHSSTKLIPANSIAIVVRSSILDKVLPSALIKVPATLNQDMKAVIPHENILVKYIYHMIGSRGSDILRAAKKTGGSVASIDSKKLFSFKIPVPNINEQQRIVEILDKFDTLTNSITEGLPREIELRQKQYEYYRDLLFSFPKPETVSN

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.54 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	263630

EcoR124I-ArdA in the Restriction-Alleviation State

1. Protein Identity and Related Structures Protein Identity & Related Structures

Antirestriction protein ArdA

State in the Current Structure

Other States of the Same Protein in the Database

Type I restriction enzyme R Protein

State in the Current Structure

Other States of the Same Protein in the Database

Type I restriction enzyme EcoR124II M protein

State in the Current Structure

Other States of the Same Protein in the Database

Type-1 restriction enzyme EcoR124II specificity protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7btr__assembly_1__model_1

7btr__assembly_1__model_1 | I(q)

7btr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

EcoR124I-ArdA in the Restriction-Alleviation State

1. Protein Identity and Related Structures Protein Identity & Related Structures

Antirestriction protein ArdA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type I restriction enzyme R Protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type I restriction enzyme EcoR124II M protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type-1 restriction enzyme EcoR124II specificity protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7btr__assembly_1__model_1

7btr__assembly_1__model_1 | I(q)

7btr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)