SAXSdb — 7bst

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type I restriction enzyme R Protein

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Type I restriction enzyme EcoR124II M protein × 2 （P10484） Overcome classical restriction gp0.3 × 2 （P03775） Type-1 restriction enzyme EcoR124II specificity protein × 1 （P10485）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q304R3_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–1038； UniProt 1–1038 Author chain C； PDBConstruct 1–1038； UniProt 1–1038

Type I restriction enzyme EcoR124II M protein

Escherichia coli

UniProt P10484

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Type I restriction enzyme R Protein × 2 （Q304R3） Overcome classical restriction gp0.3 × 2 （P03775） Type-1 restriction enzyme EcoR124II specificity protein × 1 （P10485）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T1M1_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–520； UniProt 1–520 Author chain E； PDBConstruct 1–520； UniProt 1–520

Overcome classical restriction gp0.3

Escherichia phage T7

UniProt P03775

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Type I restriction enzyme R Protein × 2 （Q304R3） Type I restriction enzyme EcoR124II M protein × 2 （P10484） Type-1 restriction enzyme EcoR124II specificity protein × 1 （P10485）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OCR_BPT7
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 1–117； UniProt 1–117 Author chain G； PDBConstruct 1–117； UniProt 1–117

Type-1 restriction enzyme EcoR124II specificity protein

Escherichia coli

UniProt P10485

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Type I restriction enzyme R Protein × 2 （Q304R3） Type I restriction enzyme EcoR124II M protein × 2 （P10484） Overcome classical restriction gp0.3 × 2 （P03775）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	T1S1_ECOLX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 1–404； UniProt 1–404

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bst
Deposition date deposition_date	2020-03-31
Structure title title	EcoR124I-Ocr in the Intermediate State
Keywords keywords	Cryoelectron microscopy, Innate immune mechanism, Complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bst__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bst__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bst__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	57.58 Å
Rg (electron density)	57.45 Å
Total Rg	57.57 Å
Atom count	28266
Residues	3508
Excluded volume	502130 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bst__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Type I restriction enzyme R Protein
Molecular weight formula_weight	120278.9 kDa
EC 编号 ec_number	3.1.21.3
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C
Atom count atom_count	28266

MTHQTHTIAESNNFIVLDKYIKAEPTGDSYQSESDLERELIQDLRNQGYEFISVKSQSAMLANVREQLQNLNGVVFNDSEWRRFTEQYLDNPSDGILDKTRKIHIDYICDFIFDDERLENIYLIDKKNLMRNKVQIIQQFEQAGSHANRYDVTILVNGLPLVQIELKKRGVAIREAFNQIHRYSKESFNSENSLFKYLQLFVISNGTDTRYFANTTKRDKNSFDFTMNWAKSDNTLIKDLKDFTATCFQKHTLLNVLVNYSVFDSSQTLLVMRPYQIAATERILWKIKSSFTAKNWSKPESGGYIWHTTGSGKTLTSFKAARLATELDFIDKVFFVVDRKDLDYQTMKEYQRFSPDSVNGSENTAGLKRNLDKDDNKIIVTTIQKLNNLMKAESDLPVYNQQVVFIFDECHRSQFGEAQKNLKKKFKRYYQFGFTGTPIFPENALGSETTASVFGRELHSYVITDAIRDEKVLKFKVDYNDVRPQFKSLETETDEKKLSAAENQQAFLHPMRIQEITQYILNNFRQKTHRTFPGSKGFNAMLAVSSVDAAKAYYATFKRLQEEAANKSATYKPLRIATIFSFAANEEQNAIGEISDETFDTSAMDSSAKEFLDAAIREYNSHFKTNFSTDSNGFQNYYRDLAQRVKNQDIDLLIVVGMFLTGFDAPTLNTLFVDKNLRYHGLMQAFSRTNRIYDATKTFGNIVTFRDLERSTIDAITLFGDKNTKNVVLEKSYTEYMEGFTDAATGEAKRGFMTVVSELEQRFPDPTSIESEKEKKDFVKLFGEYLRAENILQNYDEFATLKALQQIDLSDPVAVEKFKAEHYVDDEKFAELQTIRLPADRKIQDYRSAYNDIRDWQRREKEAEKKEKSTTDWDDVVFEVDLLKSQEINLDYILGLIFEHNRQNKGKGEMIEEVKRLIRSSLGNRAKEGLVVDFIQQTNLDDLPDKASIIDAFFTFAQREQQREAEALIKEENLNEDAAKRYIRTSLKREYATENGTELNETLPKLSPLNPQYKTKKQAVFQKIVSFIEKFKGVGGKI

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Type I restriction enzyme EcoR124II M protein
Molecular weight formula_weight	58077.1 kDa
EC 编号 ec_number	2.1.1.72
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E

MKMTSIQQRAELHRQIWQIANDVRGSVDGWDFKQYVLGALFYRFISENFSSYIEAGDDSICYAKLDDSVITDDIKDDAIKTKGYFIYPSQLFCNVAAKANTNDRLNADLNSIFVAIESSAYGYPSEADIKGLFADFDTTSNRLGNTVKDKNARLAAVLKGVEGLKLGDFNEHQIDLFGDAYEFLISNYAANAGKSGGEFFTPQHVSKLIAQLAMHGQTHVNKIYDPAAGSGSLLLQAKKQFDNHIIEEGFFGQEINHTTYNLARMNMFLHNINYDKFDIKLGNTLTEPHFRDEKPFDAIVSNPPYSVKWIGSDDPTLINDERFAPAGVLAPKSKADFAFVLHALNYLSAKGRAAIVCFPGIFYRGGAEQKIRQYLVDNNYVETVISLAPNLFFGTTIAVNILVLSKHKTDTNVQFIDASELFKKETNNNILTDAHIEQIMQVFASKEDVAHLAKSVAFETVVANDYNLSVSSYVEAKDNREIIDIAELNAELKTTVSKIDQLRKDIDAIVAEIEGCEVQK

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Overcome classical restriction gp0.3
Molecular weight formula_weight	13819.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G

MAMSNMTYNNVFDHAYEMLKENIRYDDIRDTDDLHDAIHMAADNAVPHYYADIFSVMASEGIDLEFEDSGLMPDTKDVIRILQARIYEQLTIDLWEDAEDLLNEYLEEVEEYEEDEE

Source Source

Source organism organism	Escherichia phage T7
NCBI taxonomy ID ncbi_taxonomy_id	10760
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Type-1 restriction enzyme EcoR124II specificity protein
Molecular weight formula_weight	46235.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSEMSYLEKLLDGVEVEWLPLGEITKYEQPTKYLVKAKDYHDTYTIPVLTAGKTFILGYTNETHGIYQASKAPVIIFDDFTTANKWVDFDFKAKSSAMKMVTSCDDNKTLLKYVYYWLNTLPSEFAEGDHKRQWISNYSQKKIPIPCPDNPEKSLAIQSEIVRILDKFTALTAELTAELNMRKKQYNYYRDQLLSFKEGEVEWKTLGEIGKWYGGGTPSKNKIEFWENGSIPWISPKDMGRTLVDSSEDYITEEAVLHSSTKLIPANSIAIVVRSSILDKVLPSALIKVPATLNQDMKAVIPHENILVKYIYHMIGSRGSDILRAAKKTGGSVASIDSKKLFSFKIPVPNINEQQRIVEILDKFDTLTNSITEGLPREIELRQKQYEYYRDLLFSFPKPETVSN

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.37 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	64585

EcoR124I-Ocr in the Intermediate State

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type I restriction enzyme R Protein

State in the Current Structure

Other States of the Same Protein in the Database

Type I restriction enzyme EcoR124II M protein

State in the Current Structure

Other States of the Same Protein in the Database

Overcome classical restriction gp0.3

State in the Current Structure

Other States of the Same Protein in the Database

Type-1 restriction enzyme EcoR124II specificity protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bst__assembly_1__model_1

7bst__assembly_1__model_1 | I(q)

7bst__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

EcoR124I-Ocr in the Intermediate State

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type I restriction enzyme R Protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type I restriction enzyme EcoR124II M protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Overcome classical restriction gp0.3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type-1 restriction enzyme EcoR124II specificity protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bst__assembly_1__model_1

7bst__assembly_1__model_1 | I(q)

7bst__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)