SAXSdb — 7bv6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vesicle-associated membrane protein 8

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Syntaxin-17 × 1 （P56962） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Syntaxin-17 × 1 （P56962） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Syntaxin-17 × 1 （P56962） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	Syntaxin-17 × 1 （P56962） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 4	Syntaxin-17 × 1 （P56962） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	Syntaxin-17 × 1 （P56962） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VAMP8_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–68； UniProt 8–75 Author chain E； PDBConstruct 1–68； UniProt 8–75 Author chain I； PDBConstruct 1–68； UniProt 8–75 Author chain M； PDBConstruct 1–68； UniProt 8–75 Author chain Q； PDBConstruct 1–68； UniProt 8–75 Author chain U； PDBConstruct 1–68； UniProt 8–75

Syntaxin-17

Homo sapiens

UniProt P56962

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Synaptosomal-associated protein 29 × 1 （O95721） Synaptosomal-associated protein 29 × 1 （O95721）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	STX17_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–87； UniProt 142–228 Author chain F； PDBConstruct 1–87； UniProt 142–228 Author chain J； PDBConstruct 1–87； UniProt 142–228 Author chain N； PDBConstruct 1–87； UniProt 142–228 Author chain R； PDBConstruct 1–87； UniProt 142–228 Author chain V； PDBConstruct 1–87； UniProt 142–228

Synaptosomal-associated protein 29

Homo sapiens

UniProt O95721

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Syntaxin-17 × 1 （P56962）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Syntaxin-17 × 1 （P56962）	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Syntaxin-17 × 1 （P56962）	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Syntaxin-17 × 1 （P56962）	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Syntaxin-17 × 1 （P56962）	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 4	Vesicle-associated membrane protein 8 × 1 （Q9BV40） Syntaxin-17 × 1 （P56962）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SNP29_HUMAN
Isoform	—
PDB entities	3, 4
Chains and sequence ranges	Author chain C； PDBConstruct 1–91； UniProt 40–130 Author chain G； PDBConstruct 1–91； UniProt 40–130 Author chain K； PDBConstruct 1–91； UniProt 40–130 Author chain O； PDBConstruct 1–91； UniProt 40–130 Author chain S； PDBConstruct 1–91； UniProt 40–130 Author chain W； PDBConstruct 1–91； UniProt 40–130 Author chain D； PDBConstruct 1–68； UniProt 191–258 Author chain H； PDBConstruct 1–68； UniProt 191–258 Author chain L； PDBConstruct 1–68； UniProt 191–258 Author chain P； PDBConstruct 1–68； UniProt 191–258 Author chain T； PDBConstruct 1–68； UniProt 191–258 Author chain X； PDBConstruct 1–68； UniProt 191–258

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bv6
Deposition date deposition_date	2020-04-09
Structure title title	Crystal structure of the autophagic STX17/SNAP29/VAMP8 SNARE complex
Keywords keywords	Autophagy, Synatxin 17, GABARAP, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bv6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bv6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bv6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.85 Å
Rg (electron density)	29.91 Å
Total Rg	29.74 Å
Atom count	2085
Residues	266
Excluded volume	36837 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bv6__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7bv6__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`7bv6__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`7bv6__assembly_4__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`7bv6__assembly_5__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`7bv6__assembly_6__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Vesicle-associated membrane protein 8
Molecular weight formula_weight	7981.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,I,M,Q,U
Atom count atom_count	12345

GGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFWWKNVK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Syntaxin-17
Molecular weight formula_weight	9494.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,F,J,N,R,V

HTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEEGTKNLGKAAKYK

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Synaptosomal-associated protein 29
Molecular weight formula_weight	10379.8 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G,K,O,S,W

DRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVET

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Synaptosomal-associated protein 29
Molecular weight formula_weight	7902.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,H,L,P,T,X

KNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (12 domains)

Domain ID domain_id	d7bv6a_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6b_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6e_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6f_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6i_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6j_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6m_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6n_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6q_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6r_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6u_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

Domain ID domain_id	d7bv6v_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.15 — SNARE fusion complex
Family Family family	h.1.15.0 — automated matches

▶

Unit-cell length a length_a	143.981 Å
Unit-cell length b length_b	196.000 Å
Unit-cell length c length_c	76.142 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	orthorhombic

Resolution resolution	3.050 Å
Low-resolution limit resolution_low	49.000 Å
R factor r_factor	0.1792
R_work r_work	0.1751
R_free r_free	0.2554

Crystal structure of the autophagic STX17/SNAP29/VAMP8 SNARE complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vesicle-associated membrane protein 8

State in the Current Structure

Other States of the Same Protein in the Database

Syntaxin-17

State in the Current Structure

Other States of the Same Protein in the Database

Synaptosomal-associated protein 29

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bv6__assembly_1__model_1

7bv6__assembly_1__model_1 | I(q)

7bv6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (12 domains)

7. Citations (1)

Crystal structure of the autophagic STX17/SNAP29/VAMP8 SNARE complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Vesicle-associated membrane protein 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Syntaxin-17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Synaptosomal-associated protein 29

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bv6__assembly_1__model_1

7bv6__assembly_1__model_1 | I(q)

7bv6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (12 domains)

7. Citations (1)