SAXSdb — 7bve

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integral membrane indolylacetylinositol arabinosyltransferase EmbC

Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Meromycolate extension acyl carrier protein × 2 （A0R0B3） CALCIUM ION × 2 PHOSPHATE ION × 2 Ethambutol × 2 N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	I7FMU5_MYCS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1074； UniProt 1–1074 Author chain B； PDBConstruct 1–1074； UniProt 1–1074

Meromycolate extension acyl carrier protein

OrganismNot specified

UniProt A0R0B3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Integral membrane indolylacetylinositol arabinosyltransferase EmbC × 2 （I7FMU5） CALCIUM ION × 2 PHOSPHATE ION × 2 Ethambutol × 2 N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_MYCS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–99； UniProt 1–99 Author chain D； PDBConstruct 1–99； UniProt 1–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bve
Deposition date deposition_date	2020-04-10
Structure title title	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbC2-AcpM2 in complex with ethambutol
Keywords keywords	;Mycobacterium smegmatis, cell wall synthesis, drug target, ethambutol, arabinosyltransferase, EmbC, acyl carrier protein, arabinogalactan, lipoarabinomannan, drug resistance, TRANSFERASE ;; TRANSFERASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7bve__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7bve__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7bve__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.77 Å
Rg (electron density)	43.74 Å
Total Rg	44.20 Å
Atom count	17146
Residues	2236
Excluded volume	307330 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7bve__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Integral membrane indolylacetylinositol arabinosyltransferase EmbC
Molecular weight formula_weight	116878.9 kDa
EC 编号 ec_number	2.4.2.34
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	17146

MTGPHAAGGSNHRTARLVAIIAGLLGTLMAIATPLLPVEQTTAELNWPQNGVWQSVDAPLIGYVATDLTVTVPCQAAAGLVGPENRNRSVLLSTVPKQAPKAIDRGLLIERINNDLTVIVRNTPVVSAPLEQVLSPDCRYLTFTAHADKVTGEFVGLTQGPDDDDPGEAVRGERSGYDFRPQIVGVFTDLSGPAPEGLQLSATIDTRYSTSPTLLKLLAMIVGVAMTVIALGALHVLDCADGRRHKRFLPSRWWSMTPLDGLVSAMLVWWHFVGANTADDGYILTMARVSEHAGYMANYYRWFGTPESPFGWYYDLLALWAHVSTASVWMRFPTLLMGLACWWVISREVIPRLGAAAKHSRAAAWTAAGLFLAFWLPLNNGLRPEPIIALGILLTWCSVERGVATSRLLPVAVAIIIGALTLFSGPTGIAAVGALLVAIGPLKTIVAAHVSRFGYWALLAPIAAAGTVTIFLIFRDQTLAAELQASSFKSAVGPSLAWFDEHIRYSRLFTTSPDGSVARRFAVLTLLLALAVSIAMTLRKGRIPGTALGPSRRIIGITIISFLAMMFTPTKWTHHFGVFAGLAGCLGALAAVAVTTTAMKSRRNRTVFGAAVLFVTALSFATVNGWWYVSNFGVPWSNSFPEFKFGFTTMLLGLSVLALLVAAWFHFSGRDVSPDRPQRRWQRLLVAPLAVATWALVIFEVVSLTLGMINQYPAWSVGRSNLNALTGKTCGLANDVLVEQNANAGMLTPIGEPAGQALGAVTSLGFGPNGIPSDVSADPVMEQPGTDNFADSDSGVVTGTEVGTEGGTTAAAGINGSRARLPYGLNPATTPVLGSWRSGTQQPAVLRSAWYRLPDRDQAGPLLVVSAAGRFDQGEVEVQWATDEQAAANEPGGSITFGDVGAAPAWRNLRAPLSSIPPEATQIRLVASDDDLAPQHWIALTPPRIPELRTLQEVVGSSDPVMLDWLVGLAFPCQRPFDHRYGVVEVPKWRILPDRFGAEANSPVMDYLGGGPLGITELLLRPSSVPTYLKDDWYRDWGSLQRLTPWYPDAQPARLDLGTATRSGWWSPAPLRLSHHHHHHHHHH

Source Source

Source organism organism	Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
NCBI taxonomy ID ncbi_taxonomy_id	246196
Host organism host_organism	Mycolicibacterium smegmatis MC2 155

Entity 2 Entity 2 polymer

Description description	Meromycolate extension acyl carrier protein
Molecular weight formula_weight	10743.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MAATQEEIIAGLAEIIEEVTGIEPSEVTPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAAALREKFAADQ

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	Ethambutol
Molecular weight formula_weight	204.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide
Molecular weight formula_weight	358.3 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d7bvec_
Class class	a — All alpha proteins
Fold Fold fold	a.28 — Acyl carrier protein-like
Superfamily Superfamily superfamily	a.28.1 — ACP-like
Family Family family	a.28.1.0 — automated matches

Domain ID domain_id	d7bved_
Class class	a — All alpha proteins
Fold Fold fold	a.28 — Acyl carrier protein-like
Superfamily Superfamily superfamily	a.28.1 — ACP-like
Family Family family	a.28.1.0 — automated matches

CATH v4.4 (2 domains)

Domain ID domain_id	7bveA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	610 — arabinofuranosyltransferase like domain

Domain ID domain_id	7bveB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	610 — arabinofuranosyltransferase like domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.81 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	217550

Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbC2-AcpM2 in complex with ethambutol

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integral membrane indolylacetylinositol arabinosyltransferase EmbC

State in the Current Structure

Other States of the Same Protein in the Database

Meromycolate extension acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bve__assembly_1__model_1

7bve__assembly_1__model_1 | I(q)

7bve__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbC2-AcpM2 in complex with ethambutol

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integral membrane indolylacetylinositol arabinosyltransferase EmbC

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Meromycolate extension acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7bve__assembly_1__model_1

7bve__assembly_1__model_1 | I(q)

7bve__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

6. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

CATH v4.4 (2 domains)

7. Citations (1)