SAXSdb — 9mvz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MmpL5 protein

Mycolicibacterium smegmatis

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 9 PDB declaration: nonameric（9） Consistent with protein copy count	Chain D； UniProt 1–967 Chain E； UniProt 1–967 Chain F； UniProt 1–967	Not recorded	Meromycolate extension acyl carrier protein × 3 （A0R0B3） MmpS5 protein × 3 （A0QS79） PNS 4'-PHOSPHOPANTETHEINE × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.81 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9MVZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9B46 Mycolicibacterium smegmatis MmpL5 structure Deposited 2024-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–967（967 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
9DP6 Mycolicibacterium smegmatis MmpL5-AcpM structure Deposited 2024-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–967（967 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.81 Å
9MW0 Bipartite complex of MmpL5-AcpM from Mycolicibacterium smegmatis Deposited 2025-01-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 1–967（967 aa） Chain E 1–967（967 aa） Chain F 1–967（967 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
9MX0 Cluster of bipartite complex of MmpL5-AcpM from Mycolicibacterium smegmatis Deposited 2025-01-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 1–967（967 aa） Chain D 1–967（967 aa） Chain F 1–967（967 aa） Chain H 1–967（967 aa） Chain J 1–967（967 aa） Chain L 1–967（967 aa） Chain P 1–967（967 aa） Chain Q 1–967（967 aa） Chain R 1–967（967 aa） Chain V 1–967（967 aa） Chain W 1–967（967 aa） Chain X 1–967（967 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0QS80_MYCS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain D； PDBConstruct 1–967； UniProt 1–967 Author chain E； PDBConstruct 1–967； UniProt 1–967 Author chain F； PDBConstruct 1–967； UniProt 1–967

Meromycolate extension acyl carrier protein

Mycolicibacterium smegmatis

UniProt A0R0B3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 9 PDB declaration: nonameric（9） Consistent with protein copy count	Chain G； UniProt 1–99 Chain H； UniProt 1–99 Chain I； UniProt 1–99	Not recorded	MmpL5 protein × 3 （A0QS80） MmpS5 protein × 3 （A0QS79） PNS 4'-PHOSPHOPANTETHEINE × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.81 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9MVZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BVC Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol Deposited 2020-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 1–99（99 aa）	Not recorded	CDL CARDIOLIPIN × 2 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1 CA CALCIUM ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1 PO4 PHOSPHATE ION × 1 95E Ethambutol × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BVE Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbC2-AcpM2 in complex with ethambutol Deposited 2020-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–99（99 aa） Chain D 1–99（99 aa）	Not recorded	CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 2 95E Ethambutol × 2 PN7 N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.81 Å
7BVF Cryo-EM structure of Mycobacterium tuberculosis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol Deposited 2020-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 1–99（99 aa）	Not recorded	CA CALCIUM ION × 1 95E Ethambutol × 1 DSL MONO-TRANS, OCTA-CIS DECAPRENYL-PHOSPHATE × 1 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
7BVG Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with di-arabinose. Deposited 2020-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 1–99（99 aa）	Not recorded	F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1 CDL CARDIOLIPIN × 2 CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 1 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7BVH Crystal structure of arabinosyltransferase EmbC2-AcpM2 complex from Mycobacterium smegmatis complexed with di-arabinose Deposited 2020-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–99（99 aa） Chain D 1–99（99 aa）	Not recorded	CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 2 BXY alpha-D-arabinofuranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；50mM HEPES (pH 6.8~7.5), 100mM NaCl, 5-10% (v/v) polyethylene glycol 4000, 20-30% (v/v) polyethylene glycol 200	Resolution 3.30 Å R-free 0.265
7BWR Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in substrate DPA bound asymmetric "active state" Deposited 2020-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–99（99 aa） Chain D 1–99（99 aa）	Not recorded	CA CALCIUM ION × 1 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7BX8 Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in symmetric "resting state" Deposited 2020-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–99（99 aa） Chain D 1–99（99 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8ZKP Cryo-EM structure of the efflux transporter MmpL5/MmpS5 from Mycobacterium tuberculosis, C3 symmetry Deposited 2024-05-17	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Not recorded	CDL CARDIOLIPIN × 6 PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 6 PN7 N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.64 Å
8ZKQ Cryo-EM structure of the efflux transporter MmpL5/MmpS5 from Mycobacterium tuberculosis, C1 symmetry Deposited 2024-05-17	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Not recorded	CDL CARDIOLIPIN × 6 PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 6 PN7 N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
9DP6 Mycolicibacterium smegmatis MmpL5-AcpM structure Deposited 2024-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–99（99 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.81 Å
9MW0 Bipartite complex of MmpL5-AcpM from Mycolicibacterium smegmatis Deposited 2025-01-16	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
9MX0 Cluster of bipartite complex of MmpL5-AcpM from Mycolicibacterium smegmatis Deposited 2025-01-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 1–99（99 aa） Chain C 1–99（99 aa） Chain E 1–99（99 aa） Chain G 1–99（99 aa） Chain I 1–99（99 aa） Chain K 1–99（99 aa） Chain M 1–99（99 aa） Chain N 1–99（99 aa） Chain O 1–99（99 aa） Chain S 1–99（99 aa） Chain T 1–99（99 aa） Chain U 1–99（99 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
9RFU M.tuberculosis MmpS5L5-acpM complex Deposited 2025-06-05	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 3–80（78 aa） Chain H 3–80（78 aa） Chain I 3–80（78 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	L9Q (1S)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(octadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；50 mM HEPES pH 8.0, 150 mM NaCl, 0.004% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9RGB M.tuberculosis MmpS5L5-acpM complex Deposited 2025-06-06	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	L9Q (1S)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(octadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；50 mM HEPES pH 8.0, 150 mM NaCl, 0.004% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9S2U 1:1 complex of M.tuberculosis MmpL5 and M.smegmatis AcpM Deposited 2025-07-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 3–80（78 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；50 mM HEPES pH8.0, 150 mM NaCl, 0.004% LMNG, 50 uM Bedaquiline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9U4T Cryo-EM map of MSMEG_3496 in complex with AcpM, size exclusion chromatography peak1 Deposited 2025-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–99（99 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.11 Å
9U4V Cryo-EM map of MSMEG_3496 in complex with AcpM, size exclusion chromatography peak2 Deposited 2025-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–99（99 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9U51 Cryo-EM structure of Mycobacterium tuberculosis MmpL5 in complex with AcpM Deposited 2025-03-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–99（99 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.05 Å

18 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACPM_MYCS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–99； UniProt 1–99 Author chain H； PDBConstruct 1–99； UniProt 1–99 Author chain I； PDBConstruct 1–99； UniProt 1–99

MmpS5 protein

Mycolicibacterium smegmatis

UniProt A0QS79

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 9 PDB declaration: nonameric（9） Consistent with protein copy count	Chain A； UniProt 1–138 Chain B； UniProt 1–138 Chain C； UniProt 1–138	Not recorded	MmpL5 protein × 3 （A0QS80） Meromycolate extension acyl carrier protein × 3 （A0R0B3） PNS 4'-PHOSPHOPANTETHEINE × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.81 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0QS79_MYCS2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–138； UniProt 1–138 Author chain B； PDBConstruct 1–138； UniProt 1–138 Author chain C； PDBConstruct 1–138； UniProt 1–138

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9mvz
Deposition date deposition_date	2025-01-16
Structure title title	Tripartite complex of MmpL5-S5-AcpM from Mycolicibacterium smegmatis
Keywords keywords	MmpL5, MmpS5, AcpM, membrane protein, Tripartite complex; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	62.44 Å
Radius of gyration Rg (electron density) rg_electron	63.56 Å
Forward intensity I(0) i0	1956730000.00
Molecular weight molecular_weight	376440.0 kDa
Excluded volume excluded_volume	473760 Å³
Envelope volume envelope_volume	669580 Å³
Hydration-shell volume shell_volume	98916 Å³
Envelope diameter envelope_diameter	251.9 Å
Shell Rg shell_rg	55.55 Å
Envelope Rg envelope_rg	64.35 Å
Shape Rg shape_rg	63.53 Å
Total Rg total_rg	63.43 Å
Total atoms total_atoms	26415
Residues n_residues	3468
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	223.0 Å
Rg (real space) rg_real	63.53 Å
Rg uncertainty (real space) rg_real_error	2.02 Å
I(0) (real space) i0_real	1.9530e+09
I(0) uncertainty (real space) i0_real_error	4.1710e+07
Rg (reciprocal space) rg_reciprocal	61.20 Å
I(0) (reciprocal space) i0_reciprocal	1948000000.0000
Solution quality estimate total_estimate	0.7914
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	62.4 Å
Skewness Skewness skewness	0.927
Kurtosis Kurtosis kurtosis	0.678
Angular range angular_range	— – 0.1250 Å⁻¹
Current regularization parameter α current_alpha	0.0138
Highest regularization parameter α highest_alpha	75420000.0000
Real-space data points n_real_points	26
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.513; Stabil: 0.997; Sysdev: 1.000; Positv: 1.000; Valcen: 0.974; Smooth: 0.772

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	MmpL5 protein
Molecular weight formula_weight	105598.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F
Atom count atom_count	26415

MSAPTDDTPTDAIAAPRHSAPPRPRLPWFLRTFAVPIILAWVAVVAILNTVVPTLDEVGEMRAVSMAPNDAPSTLAIKRVGQVFEEYDTSSSVMIVLEGEEPLGIEAHAFYDKMVADLRADTEHVQHVQDFWGDTLTASGAQSVDGKAAYVQVYIAGDQGESLANESVEAVRKIATERETPSGVKAYVTGAAATSADQRAEGDASMKLIEGVTFAVITVMLLAVYRSVITTLIVLAMVVLGLSGARGIVAFLGFYNVFGLTTFATNMVVTLAIAAATDYAIFLIGRYQEARRAGEDRESAYYTMFHGTAHVVLASGLTIAGATLCLHFTRLPYFQTMGVPLAIGMLIVVAAALTAGPAVISVVSRFGKTLEPKRFSRSPGWHRVGTATVRWPGAILVCAVVAALIGLLALPGYYTTYDDRRYLPDDVPANVGYDAAFRHFSQAKMNPDLMMVETDRDLRNPADFLVIDKIAKALKNVHGIAQVQTITRPDGDPIEHSTIPYTIGQSGTTQIMNNDYMQTNLDNLLKQADDLQTSIDSMTEMMNIQTELAAVSQSMADKMAQTSDDTADVRDHLADFDDFFRPIRNYLYWEPHCYDIPMCWSMRSIFESIDGINTMSDDFQELVPEMRRMADLMPRMVAVMPAQIQSMKNQKQTLLNQYQVQKAQQDQNMAMQENATAMSQAFDAAKNDDSFYLPPEAFETDDFQRGMKLFMSPDGHAVRFTIIHQGDPLTEEGTARMDELKVAAADAIKGTPFEGARIYLGGSAATYNDMQIGADYDLIIVAASALILIFIIMMVLTRAVVAAAVIVGTVVLSLASAFGLSVLLWQHIVGIPLHWMVLPMSVIVLLAVGADYNLLLVSRMKEEIHAGIRTGIIRAMVGTGAVVTAAGLVFAFTMASMAVSSLITIGQVGTTIGLGLLFDTLVVRSLMTPSIATLLGRWFWWPQRVRERPVPSKWPTPIQRTPEEALS

来源 Source

来源生物 organism	Mycolicibacterium smegmatis
NCBI Class编号 ncbi_taxonomy_id	1772
宿主生物 host_organism	Mycolicibacterium smegmatis

Entity 2 Entity 2 polymer

Description description	Meromycolate extension acyl carrier protein
Molecular weight formula_weight	10743.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I

MAATQEEIIAGLAEIIEEVTGIEPSEVTPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAAALREKFAADQ

来源 Source

来源生物 organism	Mycolicibacterium smegmatis
NCBI Class编号 ncbi_taxonomy_id	1772
宿主生物 host_organism	Mycolicibacterium smegmatis

Entity 3 Entity 3 polymer

Description description	MmpS5 protein
Molecular weight formula_weight	14905.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,A,B

MLGRIWLPVLIVVAVAAGALIVMNVRTVFGSNPVVVTEKTSDNAEDFNPKVVTYEIFGSGSSAVINYMDLEGMPQRVESTPLPWSLTLQTTLPSVMPHIMAQGDGDSITCRVTVDDVVKEERTATGMNAETFCYVKAA

来源 Source

来源生物 organism	Mycolicibacterium smegmatis
NCBI Class编号 ncbi_taxonomy_id	1772
宿主生物 host_organism	Mycolicibacterium smegmatis

Entity 4 Entity 4 non-polymer

Description description	4'-PHOSPHOPANTETHEINE
Molecular weight formula_weight	358.3 kDa
Source method src_method	syn
Copy count entity_count	3

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.81 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	31880

fit	/app/data/saxs_computation/mv/9mvz/9mvz.fit
pddf	/app/data/pr_computation/mv/9mvz/9mvz.pr.out
profile	/app/data/saxs_computation/mv/9mvz/9mvz.dat

Tripartite complex of MmpL5-S5-AcpM from Mycolicibacterium smegmatis

1. Protein Identity and Related Structures Protein Identity & Related Structures

MmpL5 protein

State in the Current Structure

Other States of the Same Protein in the Database

Meromycolate extension acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

MmpS5 protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)