SAXSdb — 7bvg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integral membrane indolylacetylinositol arabinosyltransferase EmbA

Mycolicibacterium smegmatis MC2 155

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 3 其他Polymer 1 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 1–1080	Not recorded	Integral membrane indolylacetylinositol arabinosyltransferase EmbB × 1 （I7GAQ2） Meromycolate extension acyl carrier protein × 1 （A0R0B3） alpha-D-arabinofuranose-(1-5)-alpha-D-arabinofuranose × 1 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1 CDL CARDIOLIPIN × 2 CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 1 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7BVG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BVC Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–1080（1080 aa）	Not recorded	CDL CARDIOLIPIN × 2 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1 CA CALCIUM ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1 PO4 PHOSPHATE ION × 1 95E Ethambutol × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0R613_MYCS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 9–1088； UniProt 1–1080

Integral membrane indolylacetylinositol arabinosyltransferase EmbB

Mycolicibacterium smegmatis MC2 155

UniProt I7GAQ2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 3 其他Polymer 1 PDB declaration: trimeric（3） Consistent with protein copy count	Chain B； UniProt 1–1082	Not recorded	Integral membrane indolylacetylinositol arabinosyltransferase EmbA × 1 （A0R613） Meromycolate extension acyl carrier protein × 1 （A0R0B3） alpha-D-arabinofuranose-(1-5)-alpha-D-arabinofuranose × 1 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1 CDL CARDIOLIPIN × 2 CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 1 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7BVG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
6X0O Single-Particle Cryo-EM Structure of Arabinosyltransferase EmbB from Mycobacterium smegmatis Deposited 2020-05-17	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–1082（1082 aa）	Not recorded	CA CALCIUM ION × 2 LHG 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution not provided
7BVC Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 1–1082（1082 aa）	Not recorded	CDL CARDIOLIPIN × 2 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1 CA CALCIUM ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1 PO4 PHOSPHATE ION × 1 95E Ethambutol × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BWR Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in substrate DPA bound asymmetric "active state" Deposited 2020-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1082（1082 aa） Chain B 1–1082（1082 aa）	Not recorded	CA CALCIUM ION × 1 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7BX8 Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in symmetric "resting state" Deposited 2020-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–1082（1082 aa） Chain B 1–1082（1082 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å

4 other PDB entries and 4 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	I7GAQ2_MYCS2
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1082； UniProt 1–1082

Meromycolate extension acyl carrier protein

OrganismNot specified

UniProt A0R0B3

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Other combination Heteromer Protein × 3 其他Polymer 1 PDB declaration: trimeric（3） Consistent with protein copy count	Chain P； UniProt 1–99	Not recorded	Integral membrane indolylacetylinositol arabinosyltransferase EmbA × 1 （A0R613） Integral membrane indolylacetylinositol arabinosyltransferase EmbB × 1 （I7GAQ2） alpha-D-arabinofuranose-(1-5)-alpha-D-arabinofuranose × 1 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1 CDL CARDIOLIPIN × 2 CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 1 PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.10 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7BVG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7BVC Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 1–99（99 aa）	Not recorded	CDL CARDIOLIPIN × 2 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1 CA CALCIUM ION × 2 PNS 4'-PHOSPHOPANTETHEINE × 1 PO4 PHOSPHATE ION × 1 95E Ethambutol × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
7BVE Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbC2-AcpM2 in complex with ethambutol Deposited 2020-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–99（99 aa） Chain D 1–99（99 aa）	Not recorded	CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 2 95E Ethambutol × 2 PN7 N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.81 Å
7BVF Cryo-EM structure of Mycobacterium tuberculosis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with ethambutol Deposited 2020-04-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 1–99（99 aa）	Not recorded	CA CALCIUM ION × 1 95E Ethambutol × 1 DSL MONO-TRANS, OCTA-CIS DECAPRENYL-PHOSPHATE × 1 CDL CARDIOLIPIN × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.97 Å
7BVH Crystal structure of arabinosyltransferase EmbC2-AcpM2 complex from Mycobacterium smegmatis complexed with di-arabinose Deposited 2020-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–99（99 aa） Chain D 1–99（99 aa）	Not recorded	CA CALCIUM ION × 2 PO4 PHOSPHATE ION × 2 BXY alpha-D-arabinofuranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；50mM HEPES (pH 6.8~7.5), 100mM NaCl, 5-10% (v/v) polyethylene glycol 4000, 20-30% (v/v) polyethylene glycol 200	Resolution 3.30 Å R-free 0.265
7BWR Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in substrate DPA bound asymmetric "active state" Deposited 2020-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–99（99 aa） Chain D 1–99（99 aa）	Not recorded	CA CALCIUM ION × 1 F8L [(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7BX8 Mycobacterium smegmatis arabinosyltransferase complex EmbB2-AcpM2 in symmetric "resting state" Deposited 2020-04-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 1–99（99 aa） Chain D 1–99（99 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8ZKP Cryo-EM structure of the efflux transporter MmpL5/MmpS5 from Mycobacterium tuberculosis, C3 symmetry Deposited 2024-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Not recorded	CDL CARDIOLIPIN × 6 PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 6 PN7 N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.64 Å
8ZKQ Cryo-EM structure of the efflux transporter MmpL5/MmpS5 from Mycobacterium tuberculosis, C1 symmetry Deposited 2024-05-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain D 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Not recorded	CDL CARDIOLIPIN × 6 PEV (1S)-2-{[(2-AMINOETHOXY)(HYDROXY)PHOSPHORYL]OXY}-1-[(PALMITOYLOXY)METHYL]ETHYL STEARATE × 6 PN7 N~3~-[(2S)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-N-(2-sulfanylethyl)-beta-alaninamide × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.84 Å
9DP6 Mycolicibacterium smegmatis MmpL5-AcpM structure Deposited 2024-09-20	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–99（99 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.81 Å
9MVZ Tripartite complex of MmpL5-S5-AcpM from Mycolicibacterium smegmatis Deposited 2025-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.81 Å
9MW0 Bipartite complex of MmpL5-AcpM from Mycolicibacterium smegmatis Deposited 2025-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain G 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
9MX0 Cluster of bipartite complex of MmpL5-AcpM from Mycolicibacterium smegmatis Deposited 2025-01-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 1–99（99 aa） Chain C 1–99（99 aa） Chain E 1–99（99 aa） Chain G 1–99（99 aa） Chain I 1–99（99 aa） Chain K 1–99（99 aa） Chain M 1–99（99 aa） Chain N 1–99（99 aa） Chain O 1–99（99 aa） Chain S 1–99（99 aa） Chain T 1–99（99 aa） Chain U 1–99（99 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
9RFU M.tuberculosis MmpS5L5-acpM complex Deposited 2025-06-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 3–80（78 aa） Chain H 3–80（78 aa） Chain I 3–80（78 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	L9Q (1S)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(octadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；50 mM HEPES pH 8.0, 150 mM NaCl, 0.004% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9RGB M.tuberculosis MmpS5L5-acpM complex Deposited 2025-06-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain G 1–99（99 aa） Chain H 1–99（99 aa） Chain I 1–99（99 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	L9Q (1S)-2-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-1-[(octadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8；50 mM HEPES pH 8.0, 150 mM NaCl, 0.004% LMNG cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9S2U 1:1 complex of M.tuberculosis MmpL5 and M.smegmatis AcpM Deposited 2025-07-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 3–80（78 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；50 mM HEPES pH8.0, 150 mM NaCl, 0.004% LMNG, 50 uM Bedaquiline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9U4T Cryo-EM map of MSMEG_3496 in complex with AcpM, size exclusion chromatography peak1 Deposited 2025-03-20	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–99（99 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.11 Å
9U4V Cryo-EM map of MSMEG_3496 in complex with AcpM, size exclusion chromatography peak2 Deposited 2025-03-20	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–99（99 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.09 Å
9U51 Cryo-EM structure of Mycobacterium tuberculosis MmpL5 in complex with AcpM Deposited 2025-03-20	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–99（99 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.05 Å

18 other PDB entries and 18 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ACPM_MYCS2
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain P； PDBConstruct 1–99； UniProt 1–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7bvg
Deposition date deposition_date	2020-04-10
Structure title title	Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with di-arabinose.
Keywords keywords	;Mycobacterium smegmatis, cell wall synthesis, drug target, ethambutol, arabinosyltransferase, EmbA, EmbB, EmbC, acyl carrier protein, arabinogalactan, lipoarabinomannan, drug resistance, TRANSFERASE ;; TRANSFERASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	42.66 Å
Radius of gyration Rg (electron density) rg_electron	41.66 Å
Forward intensity I(0) i0	804866000.00
Molecular weight molecular_weight	244240.0 kDa
Excluded volume excluded_volume	310110 Å³
Envelope volume envelope_volume	409610 Å³
Hydration-shell volume shell_volume	78882 Å³
Envelope diameter envelope_diameter	143.4 Å
Shell Rg shell_rg	49.34 Å
Envelope Rg envelope_rg	41.27 Å
Shape Rg shape_rg	41.64 Å
Total Rg total_rg	42.13 Å
Total atoms total_atoms	17231
Residues n_residues	2234
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	135.6 Å
Rg (real space) rg_real	42.46 Å
Rg uncertainty (real space) rg_real_error	1.21 Å
I(0) (real space) i0_real	8.0490e+08
I(0) uncertainty (real space) i0_real_error	1.4810e+07
Rg (reciprocal space) rg_reciprocal	42.66 Å
I(0) (reciprocal space) i0_reciprocal	805000000.0000
Solution quality estimate total_estimate	0.8894
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	55.0 Å
Skewness Skewness skewness	0.144
Kurtosis Kurtosis kurtosis	-0.423
Angular range angular_range	— – 0.1850 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	81130000.0000
Real-space data points n_real_points	38
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.896; Stabil: 0.999; Sysdev: 1.000; Positv: 1.000; Valcen: 0.975; Smooth: 0.896

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Integral membrane indolylacetylinositol arabinosyltransferase EmbA
Molecular weight formula_weight	116561.9 kDa
EC 编号 ec_number	2.4.2.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	17231

DYKDDDDKMTEPSRIARLIAVVAGIAGVLLCGLVPLLPVEETTATVLWPQGVGADGNVTELTAPLVAGAPRALDVTIPCRAVAELPADGGVVFSTNPAGGIEAGRNGMFIRANADVVYVAFRDTVAAVAPREAVDSGACSEIHVWADVSAVGADFAGIPDASGTLPVDKRPQVSGVFTDLKVPAQPGLAARIDIDTRFITSPTLLKTAVMVLGLACVIGSIVALALLDRGWRRRPPRTRGRAGLWTWITDTGVIGGLLIWHIVGAPTSDDGYNMTIARVASEAGYTTNYYRYFGASEAPFDWYQSVLSHLASISTAGVWMRLPATAAAIATWLIISRCVLPRIGRRVAANRVAMLTAGATFLAAWLPFNNGLRPEPLIAFAVITVWMLVENSIGTRRLWPAAVAIVIAMFSVTLAPQGLIALAPLLVGARAIGRVVTARRAGTGILASLAPLAASVAVVFVIIFRDQTLATVAESVRIKYVVGPTIPWYQEFLRYYFLTVEDSVDGSLTRRFAVLVLLLCLFGLIMVLLRRGRVPGAVSGPLWRLCGSTAIGLLLLILTPTKWAIQFGAFAGLAGALGGVTAFAFARVGLHSRRNLALYVTALLFILAWATSGLNGWFYVGNYGVPWFDKQPVIAHYPVTTIFLVLAIVGGLLAGWLHFRMDYAGHTEVADTGRNRALASTPLLIVATIMVVLELGSMVKATVGRYPVYTVGSANIAALRSAGDSCAMADAVLVEADPNEGMLQPVPGQRFGEYGPLGGEDPVGFTPNGVSDTLEPAEPVAANPGTPNSDGPVDKPNIGIGYAAGTGGGYGPEGVNGSRVFLPFGLDPSRTPVMGSYGENKLAAKATSAWYQLPPRTPDRPLVTVAAAGAIWYYEEDGSFNYGQSLKLQWGVHRPDGTYQALSEVQPIDIFQQKAWRNLRFPLAWAPPEANVARIVADDPNLSEDQWFAFTPPRVPVLQTAQQFLGSQTPVLMDIATAANFPCQRPFAERLGVAELPEYRIIPNFKQMVVSSNQWQSAADGGPFLFIQALLRTEAIPTYLRDDWYRDWGSIERYIRVVPQEQAPTAAIEEGSTRVFGWSRGGPIRALP

来源 Source

来源生物 organism	Mycolicibacterium smegmatis MC2 155
NCBI Class编号 ncbi_taxonomy_id	246196
宿主生物 host_organism	Mycolicibacterium smegmatis MC2 155

Entity 2 Entity 2 polymer

Description description	Integral membrane indolylacetylinositol arabinosyltransferase EmbB
Molecular weight formula_weight	119077.7 kDa
EC 编号 ec_number	2.4.2.34
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSGNMDEAVSGNMDEAVSAGKDVRIARWVATIAGLLGFVLSVSIPLLPVTQTTATLNWPQQGRLDNVTAPLISQAPLELTATVPCSVVRDLPPEGGLVFGTAPAEGRDAALNAMLVNVTETRVDVIVRNVVVASVNRDRVAGPDCQRIEITSNLDGTYADFVGLTQISGEDAGKLQRTGYPDPNLRPAIVGVFTDLTGPAPQGLSVSAEIDTRFTTHPTALKLAAMLLAIVSTVIALLALWRLDRLDGRRMHRLIPTRWRTVTAVDGVVVGGMAIWYVIGANSSDDGYILQMARTAEHAGYMANYFRWFGSPEDPFGWYYNVLALMTKVSDASIWIRLPDLICALICWLLLSREVLPRLGPAVAGSRAAMWAAGLVLLGAWMPFNNGLRPEGQIATGALITYVLIERAVTSGRLTPAALAITTAAFTLGIQPTGLIAVAALLAGGRPILRIVMRRRRLVGTWPLIAPLLAAGTVILAVVFADQTIATVLEATRIRTAIGPSQEWWTENLRYYYLILPTTDGAISRRVAFVFTAMCLFPSLFMMLRRKHIAGVARGPAWRLMGIIFATMFFLMFTPTKWIHHFGLFAAVGGAMAALATVLVSPTVLRSARNRMAFLSLVLFVLAFCFASTNGWWYVSNFGAPFNNSVPKVGGVQISAIFFALSAIAALWAFWLHLTRRTESRVVDRLTAAPIPVAAGFMVVVMMASMAIGVVRQYPTYSNGWANIRAFAGGCGLADDVLVEPDSNAGFLTPLPGAYGPLGPLGGEDPQGFSPDGVPDRIIAEAIRLNNPQPGTDYDWNRPIKLDEPGINGSTVPLPYGLDPKRVPVAGTYSTEAQQESRLSSAWYELPARDETERAAHPLVVITAAGTITGESVANGLTTGQTVDLEYATRGPDGTLVPAGRVTPYDVGPTPSWRNLRYPRSEIPDDAVAVRVVAEDLSLSQGDWIAVTPPRVPELQSVQEYVGSDQPVLMDWAVGLAFPCQQPMLHANGVTEVPKFRISPDYYAKLQSTDTWQDGINGGLLGITDLLLRASVMSTYLSQDWGQDWGSLRKFDTVVEATPAELDFGSQTHSGLYSPGPLRIRPHLGGIKAFHHHHHHHHHH

来源 Source

来源生物 organism	Mycolicibacterium smegmatis MC2 155
NCBI Class编号 ncbi_taxonomy_id	246196
宿主生物 host_organism	Mycolicibacterium smegmatis MC2 155

Entity 3 Entity 3 polymer

Description description	Meromycolate extension acyl carrier protein
Molecular weight formula_weight	10743.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAATQEEIIAGLAEIIEEVTGIEPSEVTPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAAALREKFAADQ

Entity 4 Entity 4 branched

Description description	alpha-D-arabinofuranose-(1-5)-alpha-D-arabinofuranose
Molecular weight formula_weight	282.2 kDa
Source method src_method	man
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	;[(2Z,6E,10E,14Z,18E,22Z,26Z)-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,10,14,18,22,26,30,34,38-decaenyl] [(2S,3S,4S,5R)-5-(hydroxymethyl)-3,4-bis(oxidanyl)oxolan-2-yl] hydrogen phosphate ;
Molecular weight formula_weight	911.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	CARDIOLIPIN
Molecular weight formula_weight	1464.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	man
Copy count entity_count	2

Entity 8 Entity 8 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 non-polymer

Description description	4'-PHOSPHOPANTETHEINE
Molecular weight formula_weight	358.3 kDa
Source method src_method	syn
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d7bvgp_
Class class	a — All alpha proteins
Fold Fold fold	a.28 — Acyl carrier protein-like
Superfamily Superfamily superfamily	a.28.1 — ACP-like
Family Family family	a.28.1.0 — automated matches

CATH v4.4 (1 domains)

Domain ID domain_id	7bvgB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	610 — arabinofuranosyltransferase like domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.10 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	209894

fit	/app/data/saxs_computation/bv/7bvg/7bvg.fit
pddf	/app/data/pr_computation/bv/7bvg/7bvg.pr.out
profile	/app/data/saxs_computation/bv/7bvg/7bvg.dat

Cryo-EM structure of Mycobacterium smegmatis arabinosyltransferase EmbA-EmbB-AcpM2 in complex with di-arabinose.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integral membrane indolylacetylinositol arabinosyltransferase EmbA

State in the Current Structure

Other States of the Same Protein in the Database

Integral membrane indolylacetylinositol arabinosyltransferase EmbB

State in the Current Structure

Other States of the Same Protein in the Database

Meromycolate extension acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)