← Back to search

9u51

Cryo-EM structure of Mycobacterium tuberculosis MmpL5 in complex with AcpM

Method: ELECTRON MICROSCOPY D_max: 122.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9u51
deposition_date	2025-03-20
title	Cryo-EM structure of Mycobacterium tuberculosis MmpL5 in complex with AcpM
keywords	Mycobacterium tuberculosis efflux pump MmpL5 in complex with meromycolate extension acyl carrier protein AcpM, MEMBRANE PROTEIN; MEMBRANE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	35.84 Å
rg_electron	35.50 Å
i0	107461000.00
molecular_weight	86974.0 kDa
excluded_volume	110720 Å³
envelope_volume	146300 Å³
shell_volume	37337 Å³
envelope_diameter	129.8 Å
shell_rg	38.45 Å
envelope_rg	35.71 Å
shape_rg	35.55 Å
total_rg	35.55 Å
total_atoms	6118
n_residues	809
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	122.9 Å
rg_real	36.27 Å
rg_real_error	1.25 Å
i0_real	1.0750e+08
i0_real_error	1.9350e+06
rg_reciprocal	36.00 Å
i0_reciprocal	107400000.0000
total_estimate	0.7844
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	30.7 Å
skewness	0.601
kurtosis	-0.285
angular_range	— – 0.2200 Å⁻¹
current_alpha	0.0000
highest_alpha	33480000.0000
n_real_points	45
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.669; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.668; Smooth: 0.518

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (2)

Entity 1 polymer

description	Siderophore exporter MmpL5
formula_weight	108926.0 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	6118

MIVQRTAAPTGSVPPDRHAARPFIPRMIRTFAVPIILGWLVTIAVLNVTVPQLETVGQIQAVSMSPDAAPSMISMKHIGKVFEEGDSDSAAMIVLEGQRPLGDAAHAFYDQMIGRLQADTTHVQSLQDFWGDPLTATGAQSSDGKAAYVQVKLAGNQGESLANESVEAVKTIVERLAPPPGVKVYVTGSAALVADQQQAGDRSLQVIEAVTFTVIIVMLLLVYRSIITSAIMLTMVVLGLLATRGGVAFLGFHRIIGLSTFATNLLVVLAIAAATDYAIFLIGRYQEARGLGQDRESAYYTMFGGTAHVVLGSGLTIAGATFCLSFTRLPYFQTLGVPLAIGMVIVVAAALTLGPAIIAVTSRFGKLLEPKRMARVRGWRKVGAAIVRWPGPILVGAVALALVGLLTLPGYRTNYNDRNYLPADLPANEGYAAAERHFSQARMNPEVLMVESDHDMRNSADFLVINKIAKAIFAVEGISRVQAITRPDGKPIEHTSIPFLISMQGTSQKLTEKYNQDLTARMLEQVNDIQSNIDQMERMHSLTQQMADVTHEMVIQMTGMVVDVEELRNHIADFDDFFRPIRSYFYWEKHCYDIPVCWSLRSVFDTLDGIDVMTEDINNLLPLMQRLDTLMPQLTAMMPEMIQTMKSMKAQMLSMHSTQEGLQDQMAAMQEDSAAMGEAFDASRNDDSFYLPPEVFDNPDFQRGLEQFLSPDGHAVRFIISHEGDPMSQAGIARIAKIKTAAKEAIKGTPLEGSAIYLGGTAAMFKDLSDGNTYDLMIAGISALCLIFIIMLITTRSVVAAAVIVGTVVLSLGASFGLSVLIWQHILGIELHWLVLAMAVIILLAVGADYNLLLVARLKEEIHAGINTGIIRAMGGSGSVVTAAGLVFAFTMMSFAVSELTVMAQVGTTIGMGLLFDTLIVRSFMTPSIAALLGKWFWWPQVVRQRPIPQPWPSPASARTFALVAAAENLYFQGLWSHPQFEKGGGSGGGSGGSAWSHPQFEK

Source

organism	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
ncbi_taxonomy_id	83332
host_organism	Mycolicibacterium smegmatis MC2 155

Entity 2 polymer

description	Meromycolate extension acyl carrier protein
formula_weight	11084.2 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

MAATQEEIIAGLAEIIEEVTGIEPSEVTPEKSFVDDLDIDXLSMVEIAVQTEDKYGVKIPDEDLAGLRTVGDVVAYIQKLEEENPEAAAALREKFAADQ

Source

organism	Mycolicibacterium smegmatis MC2 155
common_name	Mycobacterium smegmatis
ncbi_taxonomy_id	246196
host_organism	Mycolicibacterium smegmatis MC2 155

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	3.05 Å
resolution_method	—
num_particles	1975401

fit	/app/data/saxs_computation/u5/9u51/9u51.fit
pddf	/app/data/pr_computation/u5/9u51/9u51.pr.out
profile	/app/data/saxs_computation/u5/9u51/9u51.dat

Cryo-EM structure of Mycobacterium tuberculosis MmpL5 in complex with AcpM

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (2)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)